SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2NGM6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H2NGM6
Domain Number - Region: 111-152
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0152
Family FCH domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2NGM6
Sequence length 196
Comment (tr|H2NGM6|H2NGM6_PONAB) BORCS5 isoform 1 {ECO:0000313|EMBL:PNJ23196.1} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0041112 OC=Catarrhini; Hominidae; Pongo.
Sequence
MGSEQSSEAESRPNDLNSSVTPSPAKHRAKMDDIVVVAQGSQASRNVSNDPDVIKLQEIP
TFQPLLKGLLSGQTSPTNAKLEKLDSQQVLQLCLRYQDHLHQCAEAVAFDQNALVKRIKE
MDLSVETLFSFMQERQKRYAKYAEQIQKVNEMSAILRRIQMGIDQTVPLLDRLNSMLPEG
ERLEPFSMKPDRELRL
Download sequence
Identical sequences G3RZM1 H2NGM6 Q969J3
ENSP00000321546 ENSGGOP00000021264 ENSPPYP00000004917 ENSGGOP00000021264 ENSP00000321546 9600.ENSPPYP00000004917 9606.ENSP00000321546 ENSP00000321546 gi|17157999|ref|NP_477517.1| ENSPPYP00000004917 NP_477517.1.87134 NP_477517.1.92137 XP_003826597.1.60992 XP_004052794.1.27298 GO.35257 HR2423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]