SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2NHF0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2NHF0
Domain Number 1 Region: 280-357
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 9.94e-26
Family Intermediate filament protein, coiled coil region 0.00025
Further Details:      
 
Domain Number 2 Region: 50-84
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000000497
Family Intermediate filament protein, coiled coil region 0.0015
Further Details:      
 
Domain Number 3 Region: 86-157
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000146
Family Intermediate filament protein, coiled coil region 0.012
Further Details:      
 
Domain Number 4 Region: 174-281
Classification Level Classification E-value
Superfamily Prefoldin 0.0000523
Family Prefoldin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2NHF0
Sequence length 443
Comment (tr|H2NHF0|H2NHF0_PONAB) Keratin, type II cytoskeletal 8 {ECO:0000313|Ensembl:ENSPPYP00000005202} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=KRT8 OC=Catarrhini; Hominidae; Pongo.
Sequence
RISSSSSRVSSSFGLGGYGGSGMGGITAVTVNQSLSPVLEVDPNIAVRTQEKEQIKTLNN
KFASFIDKVRFLEQQNKMLETKWSLLQQQKTARSNMDNMFESYINNLRRQLETLGQEKLK
LEAELGNMQGLVEDFKNKYEDEINKRTEMENEFVLIKKDVDEAYMNKVELESRLEGLTDE
INFLRQLYEEEIRELQSQISDTSVVLSMDNSRSLDMDSIIAEVKAQYEDIANRSRAEAES
MYQIKYEELQSLAGKHGDDLRRTKTEISEMNRNISRLQAEIEGLKGQRASLEAAIADAEQ
RGELAIKDANAKLSELEAALQRAKQDMARQLREYQELMNVKLALDIEIATYRKLLEGEES
RLESGMQNMSIHTKTTSGYAGGLSSAYGGLTSPGLSYGLGSSFGSGAGSSSFSRTSSSRA
VVVKKIETRDGKLVSESSDLLPK
Download sequence
Identical sequences H2NHF0
ENSPPYP00000005202 9600.ENSPPYP00000005202 ENSPPYP00000005202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]