SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2NKF3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2NKF3
Domain Number 1 Region: 737-772
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000502
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Weak hits

Sequence:  H2NKF3
Domain Number - Region: 15-38
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0894
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2NKF3
Sequence length 813
Comment (tr|H2NKF3|H2NKF3_PONAB) Chromosome alignment maintaining phosphoprotein 1 {ECO:0000313|Ensembl:ENSPPYP00000006311} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CHAMP1 OC=Catarrhini; Hominidae; Pongo.
Sequence
MEVFQELRKPSARLECDHCSFRGTDYENVQIHMGTIHPEFCDEMDAGGLGKMIFYQKSAK
LFHCHKCFFTSKMYSNVYYHITSKHASPDKWNDKPKNQLNKETDPVKSPPLPEHQKIPCN
SAEPKSIPALSMETQKLGSVLSPESPKPTPVTPLEPQKPGSVVSPELQTPLPSPEPSKPA
CVSSPEPPKPVPVCESQKPAPVPSPEPQKLAPVSPEPVKATLSNPKPQKHSHFPETLGPP
SASSPESPVLAASPEPWGPSPAASPESRKSARTTSPELRKPSPSESPEPWKPFPAVSPEP
RRPAPAVSPGSWKPGPPGSPRPWKSSPSASSGPWKPAKPAPSVSPGPWKPIPSISPGPWK
PTPSSVSSASWKSSSVSPSSWKSPPASPESWKSGPPELRKTAPTLSPEHWKAVPPVSPEL
RKPGPPLSPEIRSPAGSPELRKPSGSPDLWKLSPDQRKTSPASLDFPESQKSSRGGSPDL
WKSSFFIEPQKPVFPETRKPGPSGPSESPKAASDIWKPVLSIDNEPRKPALFPEPAKTAP
PASPEPRKRALFPEPRKHALFPELPKSALFSESQKDVELGDELQIDAIDDQKCDILVQEE
LLASPKKLLEDTLFPSSKKLKKDNQESSDAELSSSEYIKTDLDAMDIKGQESSSDQEQVD
VESIDFSKENKMDMTSPEQSRNVLQFTEEKEAFISEEEIAKYMKRGKGKYYCKICCCRAM
KKGAVLHHLVNKHNVHSPYKCTICGKAFLLESLLKNHVAAHGQSLLKCPRCNFESNFPRG
FKKHLTHCQSRHNEEANKKLMEALEPPLEEQQI
Download sequence
Identical sequences H2NKF3
XP_002824529.3.23681 XP_003778298.2.23681 XP_003778299.2.23681 ENSPPYP00000006311 9600.ENSPPYP00000006311 ENSPPYP00000006311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]