SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2NLA0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2NLA0
Domain Number 1 Region: 27-196
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.76e-44
Family Dual specificity phosphatase-like 0.0000000331
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2NLA0
Sequence length 212
Comment (tr|H2NLA0|H2NLA0_PONAB) Cyclin-dependent kinase inhibitor 3 {ECO:0000256|PIRNR:PIRNR037322} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0009627 OC=Catarrhini; Hominidae; Pongo.
Sequence
MKPPSSIQTSEFDSSDEEPIEDEQTPIQISWLSLSRVNCSQFLGLCALPGCKFKDVRRNV
QKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCC
EIMEELTICLKNYRKTLIHCYGGLGRSCLVAACLLLYLSDTISPEQAIDSLRDLRGSGAI
QTIKQYNYLHEFRDKLAAHLSSRDSQSRSVSR
Download sequence
Identical sequences A0A096NV50 A0A2K5WR43 A0A2K6D1W7 F7FIB7 H2NLA0
ENSPANP00000016925 ENSNLEP00000015404 9544.ENSMMUP00000016171 9600.ENSPPYP00000006621 ENSPPYP00000006621 NP_001247846.1.72884 XP_002824801.1.23681 XP_003267755.1.23891 XP_005561346.1.63531 XP_011739844.1.29376 ENSMMUP00000016171 ENSMMUP00000016171 ENSPPYP00000006621 ENSNLEP00000015404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]