SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2NLR6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2NLR6
Domain Number 1 Region: 44-146,270-387
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.92e-36
Family FAD-linked reductases, N-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2NLR6
Sequence length 393
Comment (tr|H2NLR6|H2NLR6_PONAB) Uncharacterized protein {ECO:0000313|Ensembl:ENSPPYP00000006796} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN= OC=Catarrhini; Hominidae; Pongo.
Sequence
MIFTFMTRKSCYSKQVQRKYWRNCQKLTATGSAPFPLALQRFSVVWDACSEALIMFDKDN
LDDMGYIVENDVIMHALTKQLEAVSDRVTVLYRSKAIRYTWPCPFPMADSSPWVHITLGD
GSTFQPKLLIGADGHNSGVRQAAGIQNVSWNYDQSAVVATLHLSEATENNVAWQRFLPSG
PIALLPLSDTLSSLVWSTSHEHAAELVSMDEEKFVDAVNSAFWSDAAHTDFINTAGAMLQ
YAVGLLQPTKVSVRQLPPSVARVDAKSRVLFPLGLGHAAEYVRPRVALIGDAAHRVHPLA
GQGVNMGFGDISSLAHHLSTAAFNGKDLGSMSHLTGYETERQRHNTALLAATDLLKRLYS
TSASPLVLLRTWGLQATNAVSPLKEQIMAFASK
Download sequence
Identical sequences H2NLR6
ENSPPYP00000006796 9600.ENSPPYP00000006796 ENSPPYP00000006796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]