SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2NM81 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2NM81
Domain Number 1 Region: 796-845
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000165
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 427-476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000026
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 834-878
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000249
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2NM81
Sequence length 893
Comment (tr|H2NM81|H2NM81_PONAB) B-cell CLL/lymphoma 11B {ECO:0000313|Ensembl:ENSPPYP00000006970} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=BCL11B OC=Catarrhini; Hominidae; Pongo.
Sequence
MSRRKQGNPQHLSQRELITEADHVEAAILEEDEGLEIEEPSGLGLMVGGPDPDLLTCGQC
QMNFPLGDILVFIEHKRKQCGGSLGACYDKALDKDSPPPSSRSELRKVSEPVEIGIQVTP
DEDDHLLSPTKGICPKQENIAGPCRPAQLPAVAPIAVSSHSHSSVITSPLRALGALPPCL
PLPCCSARPVSGDGTQGEGQTEAPFGCQCQLSGKDEPSSYICTTCKQPFNSAWFLLQHAQ
NTHGFRIYLEPGPASSSLTPRLTIPPPLGPEAVAQSPLMNFLGDSNPFNLLRMTGPILRD
HPGFGEGRLPGTPPLFSPPPRHHLDPHRLSAEEMGLVAQHPSAFDRVMRLNPMAIDSPAM
DFSRRLRELAGNSSTPPPVSPGRGNPMHRLLNPFQPSPKSPFLSTPPLPPMPPGGTPPPQ
PPAKSKSCEFCGKTFKFQSNLIVHRRSHTGEKPYKCQLCDHACSQASKLKRHMKTHMHKA
GSLAGRSDDGLSAASSPEPGTSELAGEGLKAADGDFRHHESDPSLGHEPEEEDEEEEEEE
EELLLENESRPESSFSMDSELSRNRENGGGGVAGVPGAGGGAAKALADEKALVLGKVMEN
VGLGALPQYGELLADKQKRGAFLKRAAGGGDAGDDDDAGGCGDAGAGGAVNGRGGGFAPG
TEPFPGLFPRKPAPLPSPGLNSAAKRIKVEKDLELPPAALIPSENVYSQWLVGYAASRHF
MKDPFLGFTDARQSPFATSSEHSSENGSLRFSTPPGDLLDGGLSGRSGTASGGSTPHLGG
PGPGRPSSKEGRRSDTCEYCGKVFKNCSNLTVHRRSHTGERPYKCELCNYACAQSSKLTR
HMKTHGQIGKEVYRCDICQMPFSVYSTLEKHMKKWHGEHLLTNDVKIEQAERS
Download sequence
Identical sequences H2NM81
ENSPPYP00000006970 9600.ENSPPYP00000006970 ENSPPYP00000006970 XP_009247747.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]