SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2NNM4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2NNM4
Domain Number 1 Region: 20-241
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.07e-54
Family Ankyrin repeat 0.00021
Further Details:      
 
Weak hits

Sequence:  H2NNM4
Domain Number - Region: 794-904
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00191
Family Myosin rod fragments 0.0032
Further Details:      
 
Domain Number - Region: 910-1025
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00654
Family Myosin rod fragments 0.006
Further Details:      
 
Domain Number - Region: 1188-1241
Classification Level Classification E-value
Superfamily Coronavirus S2 glycoprotein 0.0398
Family Coronavirus S2 glycoprotein 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2NNM4
Sequence length 1403
Comment (tr|H2NNM4|H2NNM4_PONAB) Uveal autoantigen with coiled-coil domains and ankyrin repeats {ECO:0000313|Ensembl:ENSPPYP00000007486} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=UACA OC=Catarrhini; Hominidae; Pongo.
Sequence
MMNCWFSCAPKNRHAADWNKYDDRLMKAAERGDVEKVSSILAKKGVNPGKLDVEGRSVFH
VVASKGNLECLNAILIHGVDITTSDTAGRNALHLAAKYGHALCLQKLLQYNCPTEHADLQ
GRTALHDAAMADCPSSIQLLCDHGASVNAKDVDGRTPLVLATQMSRPTICQLLIDRGADV
NSRDKQNRTALMLGCEYGCRDAVEVLIKNGADISLLDALGHDSSYYARIGDNLDILTLLK
TASENTNKGRELWKKGPSLQQRNLTHMQDEVNVKSHQREHQNIQDLEIENEDLKERLRKI
QQEQRILLDKVNGLQLQLNEEVMVADDLESEREKLKSLLAAKEKQHEESLRTIEALKNRF
KYLESDHLGSGSHFSNRKEDMLLKQGQMYMADAQCTSPGIPAHIQSRSMLRPLELSLPSQ
TSYSENEILKKELEAMRTFCESAKQDRLKLQNELAHKVAECKALALECERVKEDSDEQIK
QLEDALKDVQKRMYESEGKVKQMQTHFLALKEHLTSEAASGNHRLTEELKDQLKDLKIKY
EGASAEVGKLRNQIKQNEMIVEEFKRDEGKLIEENKRLQKELSTCEMEREKKGRKVTEME
GQAKELLAKLALSIPAEKFENMKSSLSNEVNEKAKKLVEMEREHEKSLSEIRQLKRELEN
VKAKLAQHVKLEEHEQVKSRLEQKSGELGKKITELTLKNQTLQKEIEKVYLDNKLLKEQA
HNLTIEMKNHYVPLKVSEDMKKSHDAIIDDLNRKLLDVTQKYTEKKLEMEKLLLENDSLS
KDVSRLETVFVPPEKHEKEITALKSNIVELKKQLSELKKKCGEDQEKIHALMSENTNLKK
MMSNQYVPVKTHEEIKMTLNNTLAKTNRELLDVKKKFEDLNQEFVKIKDKNEILKRNLEN
TQNQIKAEYISLAEHEAKMSSLSQSMRKVQDSNAEILANYRKGQEEIVTLHAEIKAQKKE
LDTIQECIKVKYAPIVSFEECERKFKATEKELKDQLSEQTQKYSVSEEEVKKNKQENDKL
KKEIFTLQKDLRDKTVLIEKSHEMERTLSRKTDELNKQLKDLSKKYTEVKNVKEKLVEEN
AKQTSEILAVQNLLQKQHVPLEQVEALKKSLNGTIENLKEELKSMQRCYEKEQQTVTKLH
QLLENQKNSSVPLAEHLQIKEAFEKEVGIIKASLREKEEESQNKMEEVSKLQSEVQNTKQ
ALKKLETREVVDLSKYKATKSDLETQISSLNEKLANLNRKYEEVCEEVLHAKKKEISAKD
EKELLRFSIEQEIKDQKERCDKSLTTITELQRRIQESAKQIEAKDNKITELLNDVERLKQ
ALNGLSQLTYTSGNPTKRQSQLIDTLQHQVKSLEQQLADADRQHQEVIAIYRTHLLSAAQ
GHMDEDVQEALLQIIQMRQGLVC
Download sequence
Identical sequences H2NNM4
ENSPPYP00000007486 XP_002825662.1.23681 ENSPPYP00000007486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]