SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2NNR6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2NNR6
Domain Number 1 Region: 64-494
Classification Level Classification E-value
Superfamily Sema domain 1.7e-112
Family Sema domain 0.00000178
Further Details:      
 
Domain Number 2 Region: 491-527
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000523
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 3 Region: 543-619
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000762
Family I set domains 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2NNR6
Sequence length 664
Comment (tr|H2NNR6|H2NNR6_PONAB) Semaphorin 7A (John Milton Hagen blood group) {ECO:0000313|Ensembl:ENSPPYP00000007529} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=SEMA7A OC=Catarrhini; Hominidae; Pongo.
Sequence
MTPPPPGRAAPSAPRSRVPGPPARLGLPLRLLLLLWAAAASAQGHLRSGPRIFAVWKGHV
GQDRVDFGQTEPHTVLFHEPGSSSVWVGGRGKVYLFDFPEGKNASVRTVNIGSTKGSCLD
KRDCENYITLLERRSEGLLACGTNARHPSCWNLVNGTVVPLGEMRGYAPFSPDENSLVLF
EGDEVYSTIRKQEYNGKIPRFRRIRGESELYTSDTVMQNPQFIKATIVHQDQAYDDKIYY
FFREDNPDKNPEAPLNVSRVAQLCRGDQGGESSLSVSKWNTFLKAMLVCSDAATNKNFNR
LQDVFLLPDPSGQWRDTRVYGVFSNPWNYSAVCVYSLGDIDKVFRTSSLKGYHSSLPNPR
PGKCLPDQQPIPTETFQVADRHPEVAQRVEPMGPLKTPLFHSKYHYQKVAVHRMQASHGE
TFHVLYLTTDRGTIHKVVEPGEQEHSFVFNIMEIQPFRRAAAIQTMSLDAERRKLYVSSQ
WEVSQVPLDLCEVYGGGCHGCLMSRDPYCGWDHGRCVSIYSSERSVLQSINPAEPHKECP
NPKPDKAPLQKVSLAPNSRYYLSCPMESRHATYSWRHKENVEQSCEPGHQSPNCILFIEN
LTAQQYGHYFCEAQEGSYFREAQHWQLLPEDGIMAEHLLGHACALAASLWLGVLPTLTLV
LLVH
Download sequence
Identical sequences H2NNR6
ENSPPYP00000007529 XP_002825703.1.23681 9600.ENSPPYP00000007529 ENSPPYP00000007529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]