SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2NP65 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2NP65
Domain Number 1 Region: 141-616
Classification Level Classification E-value
Superfamily Sema domain 2.22e-164
Family Sema domain 0.00000000221
Further Details:      
 
Domain Number 2 Region: 618-671
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000000994
Family Plexin repeat 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2NP65
Sequence length 930
Comment (tr|H2NP65|H2NP65_PONAB) Semaphorin 4B {ECO:0000313|Ensembl:ENSPPYP00000007686} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=SEMA4B OC=Catarrhini; Hominidae; Pongo.
Sequence
PGTPRRTEAVRPRLRVPRDCAGPAWQGGRVSGHSRKSGPAGGDDRALALTHSRSGGGGPR
GDSGADRGAELLPVSPAEPPEPEPRDTVAPALRVLRAAMGPRSWLAAPWGVLPPRPPLLL
LLLLLLLLQPPPPTWALSPRISLPLGSEERPFLRFEAENISNYTALLLSRDGRTLYVGAR
EALFALNSNLSFLPGGEYQELLWGADAEKKQQCSFKGKDPQRDCQNYIKILLPLSGSHLF
TCGTAAFSPMCTYINVENFTLARDEKGNVLLEDGKGRCPFDPNFKSTALVVDGELYTGTV
SSFQGNDPAISRSQSLRPTKTESSLNWLQDPAFVASAYIPESLGSLQGDDDKIYFFFSET
GQEFEFFENTIVSRVARICKGDEGGERVLQQRWTSFLKAQLLCSRPDDGFPFNVLQDVFT
LSPSPQDWRDTLFYGVFTSQWHRGTTEGSAVCVFTMKDVQRVFNGLYKEVNRETQQWYTV
THPVPIPRPGACITNSARERKINSSLQLPDRVLNFLKDHFLMDGQVRSRMLLLQPQARYQ
RVAVHRVPGLHHTYDVLFLGTGDGRLHKAVSVGPRVHIIEELQIFSSGQPVQNLLLDTHR
GLLYAASHSGVVQVPMANCSLYRSCGDCLLARDPYCAWSGSSCKHVSLYQPELAARPWIQ
DIEGASAKDLCSASSVVSLSFVPTGEKPCEQVQFQPNTVNTLACPLLSNLATRLWLHNGA
PVNASASCHVLPTGDLLLVGTQQLGEFQCWSLEEGFQQLVASYCPEVVEDGVADQTDQGG
NVPVIISTSRVSAPAGGRASWGADKSYWKEFLVMCTLFVLAVLFPVLFLLYRHRNSMKVF
LKQGECASVHPKTCPVVLPPETRPLNGLGPPSTPLDHRGYQALSDSPPGARVFTESEKRP
LSIQDSFVEVSPVCPRPRVRLGSEIRDSVV
Download sequence
Identical sequences H2NP65
ENSPPYP00000007686 ENSPPYP00000007686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]