SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2NQS9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2NQS9
Domain Number 1 Region: 20-126,313-617
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 5.36e-65
Family Integrin alpha N-terminal domain 0.0000689
Further Details:      
 
Domain Number 2 Region: 108-335
Classification Level Classification E-value
Superfamily vWA-like 2.7e-50
Family Integrin A (or I) domain 0.0000000324
Further Details:      
 
Domain Number 3 Region: 617-772
Classification Level Classification E-value
Superfamily Integrin domains 4.71e-29
Family Integrin domains 0.0084
Further Details:      
 
Domain Number 4 Region: 774-849
Classification Level Classification E-value
Superfamily Integrin domains 0.00000000000000241
Family Integrin domains 0.0068
Further Details:      
 
Domain Number 5 Region: 856-999
Classification Level Classification E-value
Superfamily Integrin domains 0.00000000000628
Family Integrin domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2NQS9
Sequence length 1074
Comment (tr|H2NQS9|H2NQS9_PONAB) Integrin subunit alpha X {ECO:0000313|Ensembl:ENSPPYP00000008264} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=ITGAX OC=Catarrhini; Hominidae; Pongo.
Sequence
MTRTRAALLLFTALATSLGFNLDTEELTAFHVDSAGFGDSVVQYANSWVVVGAPEKITAA
NQTGGLYQCGYSTGACKPISLQVPLEAVNMSLGLSLAATTSPSRLLACGPTVHHACGRNM
YLTGLCFLLAPAQLTQRLPASRQECPRQEQDIVFLIDGSGSISSDNFATMMNFVRAVISQ
FQRPSTQFSLMQFSNKFQTHFTFEKFRSSSNPLSLLDSVHQLRGLTHTATAIQNVVHRLF
HASYGARRDAAKILIVITDGKKEGDRLDYKDVIPMADAAGIIRYAIGVGSAFEYINSWKE
LNDIASKPSQEHIFKVEDFEALKDIQNQLKEKIFAIEGTETTSSSSFELEMAQEGFSAVF
TPDGPVLGAVGSFTWSGGAFLYPPNMNPTFINMSQENMDMRDSYLGYSTELALWKGVQSL
VLGAPRYQHTGKAVIFTQVSRQWRMKAEVTGTQIGSYFGASLCSVDVDSDGSTDLVLIGA
PHYYEQTRGGQVSVCPLPRGWRRWWCDAVLYGEQGHPWGRFGAALTVLGDVNGDKLTDVV
IGAPGEEENRGAVYLFHGVLGPSISPSHSQRIAGSQLSSRLQYFGQALSGGQDLTQDGLV
DLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLGQSSICLYIDK
RSKNLLGSRDLKSSVTLDLALDPGRLSPRANFQETKNRSLSRVRVLGLEAHCENFNLLLP
TCVEDSVTPITLRLNFTLVGKPLPAFRNLRPMLAADAQRYFTASLPFEKNCGADHICQDN
LGISFSFPGLKTLLVGSNLELNAEVMVWNDGEDSYGTTITFSHPAGLSYRSVAEGQHEQF
TKYLNFSDSEEKESHVAVHRYQVNNLGQRDLPVSINFWVPVELNQEAVWMDVEVFHPQNP
SLQCSSEKIAPPASDFLSHIQKNPVLDCSIACCLRFRCDVPFFSVQEELDFTLKGNLSFG
WVRQTSQKKVSVMSVAEITFNTSVYSQLPGQEAFMRAQTTTVLEKYKVHNPTPLIVGSSI
GGLLLLALITAVLYKVGFFKRQYKEMMEEANGQIAPENGTTPNPPTPHYPQDNV
Download sequence
Identical sequences H2NQS9
9600.ENSPPYP00000008264 ENSPPYP00000008264 ENSPPYP00000008264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]