SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2NS44 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2NS44
Domain Number 1 Region: 65-125
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000131
Family HLH, helix-loop-helix DNA-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2NS44
Sequence length 235
Comment (tr|H2NS44|H2NS44_PONAB) Basic helix-loop-helix family member a9 {ECO:0000313|Ensembl:ENSPPYP00000008751} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0041389 OC=Catarrhini; Hominidae; Pongo.
Sequence
MLRGAPGLGLRARKGAEGSAEDLGGPCPEPGGDLGVLGANGASCSRGEAEEPAGRRRARP
VRSKARRMAANVRERKRILDYNEAFNALRRALRHDLGGKRLSKIATLRRAIHRIAALSLV
LRASPAPRGPCGHLECHGPAACGDTGDTGASPPPPAGPSLARPDAARPSVPSAPRCASCP
PHAPLARPSAVAEGPGLAQVSGGSWRRCPGASSAGPPPWPRGYLRSAPGMGHPRS
Download sequence
Identical sequences H2NS44
ENSPPYP00000008751 XP_002826847.1.23681 9600.ENSPPYP00000008751 ENSPPYP00000008751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]