SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2NSF3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2NSF3
Domain Number 1 Region: 714-969
Classification Level Classification E-value
Superfamily RNI-like 2.65e-47
Family 28-residue LRR 0.0000785
Further Details:      
 
Domain Number 2 Region: 1-91
Classification Level Classification E-value
Superfamily DEATH domain 2.71e-21
Family Pyrin domain, PYD 0.00000353
Further Details:      
 
Domain Number 3 Region: 1380-1466
Classification Level Classification E-value
Superfamily DEATH domain 6.12e-17
Family Caspase recruitment domain, CARD 0.02
Further Details:      
 
Domain Number 4 Region: 313-498
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000206
Family Nucleotide and nucleoside kinases 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2NSF3
Sequence length 1477
Comment (tr|H2NSF3|H2NSF3_PONAB) NLRP1 isoform 4 {ECO:0000313|EMBL:PNJ04557.1} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0053152 OC=Catarrhini; Hominidae; Pongo.
Sequence
MAGGAWGRLACYLEFLKKEELKEFQLLLANKAHSRSSSGETPAQPEKTSGMEVASYLVAQ
YGEQRAWDLALHTWEQMGLRSLCAQAQEGAGHSPSFPYSPSEPHLGSPSQPTSTAVLMPW
IHELPAGCTQGSERRVLRQLPDTSGRRWREISSSLLYQALPSSPDYESPSQESPNAPTST
AVLGSWGSPPQPSLAPREQEAPGTQWPLDEMSGIYYAEIREREREKSEKGRPPWAAAVGT
PPQAHTSLQPHRHPWEPSVRESLCSTWPWKNEDLNQKFTQLLLLQRPHPRSQVPLFKGSW
PHYVEENRGHLIEIRDLFGPGLDTQEPRIVILQGAAGIGKSTLARQVKEAWGRGQLYGER
FQHVFYFSCRELAQSKVVSLAELIGKDWTVTQAPIRQILSMPERLLFILDGVDEPGWVLQ
EPSSELCLHWSQPQQADALLGSLLGKTILPEASFLITARTTALQNLIPSLEQARWVEVLG
FSESSRKEYFYKYFTDERQAIRAFRLVKSNKELWALCLVPWVSWLACACLMQQMKRKEKL
TLTSKTTTTLCLHYLSQALQAQPLGPQLRDLCSLAAEGIWQKKTLFSPDDLRKHGLDGAV
ISTLLKMGILQEHPIPLSYSFIHLCFQEFFAAMSYALENKKGKGKHSNCIIDLEKLLEAY
GTHGLFGASTTRFLLGLLSDEGEREMENIFHCQLSQGRNLMRWVPSLQLLLQPHSLESLH
CLYETRNKTFLTRVMAHFEEMGMCVETDMELLVSTFCIKFSRHVKKLQLIEGRQHRSTWS
PTMVVLFRWAPVTDAYWQILFSVLKVTRNLKELDLSGNSLSRSAVKSLCKTLRCPRCLLE
TLRLAGCGLIAEDCKDLASGLRANWTLTKLDLSFNVLTDAGAKHLCQRLRQPSCKLQRLQ
LVSCGVTSDCCQDLASVLSASPILKELDLQQNNLDDAGVRLLCEGLRHPACKLIRLGLDQ
TTLSDEMRQELRALEQEKPQLLIFSRRKPSVMTPIEGLDTGETSNSTSSLKRQRLRSETE
PSHIAQADLKRLDWSNPPAKASQSAGITEGSSPEVAQVEPLCLPSPASQGDLHTKALGTD
DDFWGPTGPVAAEIVDKEKSLYRVHFPVAGSYRWPNMGLCFVVREAVTVEIEFCVWDQFL
GEINPQHSWMVAGPLLDIKAEPGAVEAVHLPHFVALQGGHVDTSLFQVAHFKEEGMLLEK
PARVELHHIVLENPSFSPLGVLLKMIHNALRFLPVTSVVLLYHRLHPEEVTFHLYLIPSD
CSIRKAIDDLEMKFQFVRIHKPPPLTPLYMGCRYTVSGSGSGMLEILPKELELCYRSPGE
DQLFSEFYVGHLGSGIRLQVKDKKDETLVWEALVKPGDLMPATALVPPACIAVPSPLDAP
RLLHFVDQYREQLIARVTSVEVVLDKLHGQVLSQEQYERVLAEDTRPSQMRKLFSLSQSW
DRRCKDRLYQALKETHPHLIMELWEKGSKKGLLPLSS
Download sequence
Identical sequences H2NSF3
ENSPPYP00000008863 9600.ENSPPYP00000008863 ENSPPYP00000008863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]