SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2NSL6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2NSL6
Domain Number 1 Region: 903-1178
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.14e-71
Family Tandem AAA-ATPase domain 0.0000316
Further Details:      
 
Domain Number 2 Region: 669-901
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.46e-53
Family Tandem AAA-ATPase domain 0.0000713
Further Details:      
 
Domain Number 3 Region: 545-618
Classification Level Classification E-value
Superfamily Chromo domain-like 2.36e-16
Family Chromo domain 0.0059
Further Details:      
 
Domain Number 4 Region: 330-386
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.21e-16
Family PHD domain 0.0016
Further Details:      
 
Domain Number 5 Region: 407-469
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000142
Family PHD domain 0.0001
Further Details:      
 
Domain Number 6 Region: 469-528
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0000000000192
Family Chromo domain 0.022
Further Details:      
 
Domain Number 7 Region: 121-160
Classification Level Classification E-value
Superfamily HMG-box 0.0000768
Family HMG-box 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2NSL6
Sequence length 1918
Comment (tr|H2NSL6|H2NSL6_PONAB) Chromodomain helicase DNA binding protein 3 {ECO:0000313|Ensembl:ENSPPYP00000008928} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CHD3 OC=Catarrhini; Hominidae; Pongo.
Sequence
MKEADTVILWARSKNDQLRISFPPGLCWGDRMPDSEEEFGSERYDYREKSESGGSEYGTG
PGLKRITKHREKNEKNTKRRKKGEGDGGQKQVEQKSSATLLLTWGLEDVEHVFSEEDYHT
LTNYKAFSQFMRPLIAKKNPKIPMSKMMTILGAKWREFSANNPFKGSAAAVAAAAAAAAA
AVAEQVSAAVSSATPIAPSGPPALPPPPAADIQPPPIRRAKTKEGKGPGHKRRSKSPRVD
GRKKLRGKKMAPLKIKLGLLGGKRKKGGSYVFQSDEGPEPEAEESDLDSGSVHSASGRPD
GPVRTKKLKRGRPGRKKKKVLGCPAVAGEEEVDGYETDHQDYCEVCQQGGEIILCDTCPR
AYHLVCLDPELDRAPEGKWSCPHCEKEGVQWEAKEEEEEYEEEGEEEGEKEEEDDHMEYC
RVCKDGGELLCCDACISSYHIHCLNPPLPDIPNGEWLCPRCTCPVLKGRVQKILHWRWGE
PPVAVPAPQQADGNPDVPPPRPLQGRSEREFFVKWVGLSYWHCSWAKELQSGEDDGKSDK
RKVKDPHYAEMEEKYYRFGIKPEWMTVHRIINHSVDKKGNYHYLVKWRDLPYDQSTWEED
EMNIPEYEEHKQSYWRHRELIMGEDPAQPRKYKKKKKELQGDGPPSSPTNDPTVKYETQP
RFITATGGTLHMYQLEGLNWLRFSWAQGTDTILADEMGLGKTIQTIVFLYSLYKEGHTKG
PFLVSAPLSTIINWEREFQMWAPKFYVVTYTGDKDSRAIIRENEFSFEDNAIKGGKKAFK
MKREAQVKFHVLLTSYELITIDQAALGSIRWACLVVDEAHRLKNNQSKFFRVLNGYKIDH
KLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADISKEDQIKKLHDLLGPHMLR
RLKADVFKNMPAKTELIVRVELSPMQKKYYKYILTRNFEALNSRGGGNQVSLLNIMMDLK
KCCNHPYLFPVAAMESPKLPSGAYEGGALIKSSGKLMLLQKMLRKLKEQGHRVLIFSQMT
KMLDLLEDFLDYEGYKYERIDGGITGALRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLA
TADTVIIFDSDWNPHNDIQAFSRAHRIGQANKVMIYRFVTRASVEERITQVAKRKMMLTH
LVVRPGLGSKAGSMSKQELDDILKFGTEELFKDENEGENKEEDSSVIHYDNEAIARLLDR
NQDATEDTDVQNMNEYLSSFKVAQYVVREEDKIEEIEREIIKQEENVDPDYWEKLLRHHY
EQQQEDLARNLGKGKRVRKQVNYNDAAQEDQDNQSEYSVGSEEEDEDFDERPEGRRQSKR
QLRNEKDKPLPPLLARVGGNIENTQRALAVMRWMPQTLIQLRDRKTEKEFKAYVSLFMRH
LCEPGADGSETFADGVPREGLSRQQVLTRIGVMSLVKKKVQEFEHINGRWSMPELMPDPS
ADSKRSSRASSPTKTSPTTPEASAANSPCTSKPATPAPSEKGEGIRTPLEKEEAENQEEK
PEKNSRIGEKMETEADAPSPAPSLGERLEPRKIPLEDEVPGVPGEMEPEPGYRGDREKSA
TESTPGERGEEKPLDGQEHRERPEGETGDLGKREDAKGDRELRPGPRDEPRSNGRREEKT
EKPRFMFNIADGGFTELHTLWQNEERAAISSGKLNEIWHRRHDYWLLAGIVLHGYARWQD
IQNDAQFAIINEPFKTEANKGNFLEMKNKFLARRFKLLEQALVIEEQLRRAAYLNLSQEP
AHPAMALHARFAEAECLAESHQHLSKESLAGNKPANAVLHKVLNQLEELLSDMKADVTRL
PATLSRIPPIAARLQMSERSILSRLASKGTEPHPTPAFPPGPYATPPGYGAAFSAAPVGA
LAAAGANYSQMPAGSFITAATNGPPVLVKKEKEMVGALVSDGLDRKEPRAGEVICIDD
Download sequence
Identical sequences H2NSL6
ENSPPYP00000008928 9600.ENSPPYP00000008928 ENSPPYP00000008928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]