SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2NSM4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2NSM4
Domain Number 1 Region: 12-68
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000157
Family HLH, helix-loop-helix DNA-binding domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2NSM4
Sequence length 225
Comment (tr|H2NSM4|H2NSM4_PONAB) Hes family bHLH transcription factor 7 {ECO:0000313|Ensembl:ENSPPYP00000008936} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0048030 OC=Catarrhini; Hominidae; Pongo.
Sequence
MVTRDRAENRDGPKMLKPLVEKRRRDRINRSLEELRLLLLERTRDQNLRNPKLEKAEILE
FAVGYLRERSRVEPPGVPRSPVQDAEALASCYLSGFRECLLRLAAFAHDASPAARAQLFS
ALHGYLRPKPPRPKPVDPRPPAPRPSLDPAAPALGPALHQRPPMHQGPPSPRCAWSPSLC
SPRAGDSGAPAPLTGLLPPPPPPHRQDGAPKAPPPPPPAFWRPWP
Download sequence
Identical sequences A0A2I3GQD3 H2NSM4
ENSPPYP00000008936 9600.ENSPPYP00000008936 XP_002827045.1.23681 XP_003274690.1.23891 ENSPPYP00000008936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]