SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2NTM3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2NTM3
Domain Number 1 Region: 431-566
Classification Level Classification E-value
Superfamily TIMP-like 1.73e-31
Family Netrin-like domain (NTR/C345C module) 0.034
Further Details:      
 
Domain Number 2 Region: 208-303
Classification Level Classification E-value
Superfamily Immunoglobulin 1.97e-20
Family I set domains 0.0079
Further Details:      
 
Domain Number 3 Region: 384-436
Classification Level Classification E-value
Superfamily BPTI-like 8.66e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.002
Further Details:      
 
Domain Number 4 Region: 323-379
Classification Level Classification E-value
Superfamily BPTI-like 6.53e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.015
Further Details:      
 
Domain Number 5 Region: 122-172
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000132
Family Ovomucoid domain III-like 0.033
Further Details:      
 
Domain Number 6 Region: 37-87
Classification Level Classification E-value
Superfamily Elafin-like 0.0000575
Family Elafin-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2NTM3
Sequence length 575
Comment (tr|H2NTM3|H2NTM3_PONAB) WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 2 {ECO:0000313|Ensembl:ENSPPYP00000009295} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=WFIKKN2 OC=Catarrhini; Hominidae; Pongo.
Sequence
MWALRCHRFWSRWEQVAALLLLLLLLGVPPRSLALPPIRYSHAGICPNDMNPNLWVDAQS
TCRRECETDECETYEKCCPNVCGTKSCVAARYMDVKGKKGPVGMPKEATCDHFMCLQQGS
ECDIWDGQPVCKCKDRCEKEPSFTCASDGLTYYNRCYMDAEACSKGITLAVVTCRYHFTW
PNTSPPPPETTMHPTTASPETPELDMAAPALLNNPVHQSVTMGETVSFLCDVVGRPRPEI
TWEKQLEDGENVVMRPNHVRGNVVVTNIAQLVIYNAQLQDAGIYTCTARNVAGVLRADFP
LSVVRGHQAAATSESSPNGTAFPAAECLKPPDSEDCGEEQTRWHFDAQANNCLTFTFGHC
HRNLNHFETYEACMLACMSGPLAACSLPALQGPCKAYAPRWAYNSQTGQCQSFVYGGCEG
NGNNFESREACEESCPFPRGNQRCRACKPRQKLVTSFCRSDFVILGRVSELTEEPDSGRA
LVTVDEVLKDEKMGLKFLGREPLEVTLLHVDWACPCPNVTVSETPLIIMGEVDGGMAVLH
PDSFVGASSARRVRKLREVMHKKTCDVLKEFLGLH
Download sequence
Identical sequences H2NTM3
ENSPPYP00000009295 9600.ENSPPYP00000009295 ENSPPYP00000009295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]