SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2NU86 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2NU86
Domain Number 1 Region: 416-609
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.3e-68
Family Nuclear receptor ligand-binding domain 0.0000242
Further Details:      
 
Domain Number 2 Region: 129-216
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.59e-19
Family Nuclear receptor 0.0000909
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2NU86
Sequence length 612
Comment (tr|H2NU86|H2NU86_PONAB) Nuclear receptor subfamily 1 group D member 1 {ECO:0000313|Ensembl:ENSPPYP00000009517} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=NR1D1 OC=Catarrhini; Hominidae; Pongo.
Sequence
MTTLDSNNNTGGVITYIGSSGSSPSRTSPESLYSDNSNGSFQSLTQGCPTYFPPSPTGSL
TQDPARSFGSIPPSLSDDGSPSSSSSSSSSSSSFYNGSPPGSLQVAMEDSSRVSPSKSTS
NITKLNGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKRCLKNENCSVCIN
RNRCQQCRFECLSWACLRDAVRFGRIPKREKQRMLAEMQSAMNLANNQLSSQCPLETSPT
QHPTPGPMGPSPPPAPVPSPLVGFSQFPQQLTPPRSPSPEPTVEDVISQVARAHREIFTY
AHDKLGSSPGNFNANHASGSPPATTPHRWENQGCPPAPNDNNILAAQRHNEALNGLRQAP
SSYPPTWSPGPAHHSCHQSNSNGHRLCPTHVYAAPEGKAPANDPRQGSSKNVLLACPMNM
YPHGRSGRTVQEIWEDFSMSFTPAVREVVEFAKHIPGFRDLSQHDQVTLLKAGTFEVLMV
RFASLFNVKDQTVMFLSRTTYSLQELGAMGMGDLLNAMFDFSEKLNSLALTEEELGLFTA
VVLVSADRSGMENSASVEQLQETLLRALRALVLKNRPLETSRFTKLLLKLPDLRTLNNMH
SEKLLSFRVDAQ
Download sequence
Identical sequences H2NU86
ENSPPYP00000009517 ENSPPYP00000009517 9600.ENSPPYP00000009517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]