SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2NUZ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2NUZ3
Domain Number 1 Region: 3157-3201
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000165
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 2 Region: 1623-1773
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000328
Family Extended AAA-ATPase domain 0.075
Further Details:      
 
Domain Number 3 Region: 1982-2194
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000045
Family Extended AAA-ATPase domain 0.043
Further Details:      
 
Weak hits

Sequence:  H2NUZ3
Domain Number - Region: 3230-3257,3285-3341,3511-3636,3736-3811,3842-3863
Classification Level Classification E-value
Superfamily ARM repeat 0.000108
Family HEAT repeat 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2NUZ3
Sequence length 4365
Comment (tr|H2NUZ3|H2NUZ3_PONAB) Uncharacterized protein {ECO:0000313|Ensembl:ENSPPYP00000009784} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN= OC=Catarrhini; Hominidae; Pongo.
Sequence
MEHLCHFPAHILDCFLGIYYRLPGLQKVWNMQDVQNVQNILKMLLHLLDTYQDKIPEEAL
SPSYLIVCLKLHEAICSSTKIPKFYELPALSAEIVCRMIILLSLVDSAGQGDETGNNSVQ
TVFQGTLAATKRWLQEVFTENMLAYSGASFTYVEEIEVWRRLVEIHFPMEHGWKESLLGD
MEWRLKQEKPLSQITAYCNSRWDTKGLEDSVAKTFEKCAIEAVSSACQSQTSILQGLSCS
DLRKFGTLLSAVITKSWPRNNGEAVDDFDDILKHLLTLADVKHLFRLCGTDEKIRANITQ
DGKKLMAAADSVFTKVVGDLLTGTILVGQLELIIKHKNQFLDIWQLKEKSLSPQDEKYAV
EEALDWRMEELLFLKKEKRCVDSLLKMCGNVKHLIQVDFGVLAVRYSQDLSSKRLNEAVT
VRLSTSSNSQRTTHYDLSSRVREMAGKIDLLRDSHIFQIFWREAAEPLGEPKEDREAAEL
LSEPEEESERHILELEEVYDYLYQPSYRKFIKLYQDLKSGEVTLAEIDVIFKDFVNKYMD
LDSELKIMCTVDHQGQRDWIKERVEQIKEYHHLHQAVHAAKVILQVKESLGLTGDFSVLN
TLLNFTDNFDDFRHETLDQINQELIRAKKLLQDISEARCKGLKALSLRKDFICWVREALG
GINELKVFVDLASISAGENDIDVDRVACFHDAVQGYASLLFKLDPRVGFSAFMKHLKELW
KALDNDQYLPRKLCDSARNLEWLKTVKESHGSVELSSLTLATAINQRGIYVIQAPKGGQK
ISPDTVLHLILPESPGSHEERREYSLEELKELLNKLMLMSGKKDHNNTEVERFSEVFCSV
QRLSQAFIDLHSAGNMLFRTWIATAYCSPKQGVSLQMDFGLDLVTKLAEGGDVIELLAAL
CRQMEHFLDSWKRFVTQKRMEHFYLNFYTAEQLVYLSTELRKQPPSDAALTMLSFIKSNC
TLRDVLRASVGCESEAARYRMRTVMEELPLMLFSEFSLVDKLRVIMEQSMGCLPAFLPDC
LDLETLGRCLAHLAGMGGSPVERCLPRGLQVGQPNLVVCGHSEVLPAALAVYMQTPSQPL
PTYDEVLLCTPATTFEEVALLLRRCLTLGSPGHKVYSLLFADQLSYEVARQAEKLFQKLC
TQQHREDYQLVMVCDGDWEHCYLPSAFSQHKVFVTPQAPLEAIQAYLAGHYRVPKQTLSA
AAVFKDRLCVGIVASERAGVGKSLYVKRLHDKLKMQLNVKKVPLKTIRLIDPQVDESQVL
GALLPFLDVQYQKVPVLFHLDVTSSVQSGIWVFLFKLLILQYLMDINGKMWLRNPCHLYI
VEILERRTSVPSRRSSTLRTRVPQFSFLDIFPKVTCRPPKEVIDMELSPRRSDTEPGMDQ
WEFCSETFQRPYQYLRRFHQNQNLDTFQYQEGSVEGTPEECLQHFLIYCGVINPSWSELR
NFARFLNYQLRDCEASLFCNPSFIGDTLRGFKNFVVTFMIFMARDFATPSLHTSDESPGK
HMVTMDGVREEDLAPFSLRKRWESEPHPYVFFNDDHTTMTFIGFHLQPNSKGSVDAINHL
TRKVIKRDVMTTDLYQGLLLQRVPFNVDFDKLPRHEKLERLCLTLGIPWATDPDKTYELT
TDNMLKILAIEMRFRCGIPVIIMGETGCGKTRLIKFLSDLRRGGANSDTIKLVKVHGGTT
ADMIYSRVREAEDVAFANKDQHQLDTILFFDEANTTEAISCIKEVLCDRMVDGQPLAEDS
GLHIIAACNPYRKHSEEMICRLESAGLGYRVSMEETADRLGSIPLRQLVYRVHALPPSLI
PLVWDFGQLSDVAEKLYIQQIVQRLVDSISLDENGTRVITEVLCASQGFMRKREDECSFV
SLRDVERCVKVFRWFHEHSAMLLAQLNAFLSKSRVSKDHTKRDPVLWSLMLAIGVCYHAS
LEKKDSYRKAIARFFPKPYDDSRLLLDEITRAQDLFLDGVPLRKTIAKNLALKENVFMMV
ICIELKIPLFLVGKPGSSKSLAKTIVADAMQGPAAYSDLFRSLKQVHLVSFQCSPHSTPQ
GIISTFRQCARFQQGKDLQQYVSVVVLDEVGLAEDSPKMPLKTLHPLLEDGCIEDDPAPH
KKVGFVGISNWALDPAKMNRGIFVSRGSPNKRELIESAKGICSSDILVQDRVQGYFSSFA
KAYETVCESQDKEFFGLRDYYSLIKMVFAAAKASNRKPSPQDIAQAVLRNFSGKDDIRAL
DIFLANLPEAKSSEEVSPVQLIKQNIFGPSQKVPDGQLEDAESRYLLVLTKNYVALQILQ
QTFFEEDQQPEIIFGSGFPKDQEYTQICRNINRVKICMETGKMVLLLNLQNLYESLYDAL
NQYYVHLGGQKYVDLGLGTHRVKCRVHPNFRLIVIEEKDVVYKHFPIPLINRLEKHYLDI
NTVLEKWQKSIVEELRAWVEKFINVKADHFLNRHKYSPSDVFIGYHSDACASVVLQVIER
RGPRALTEELYQKVSGEAKLILLNCATPDAMVRLSAYSLGGFAGKSLSREYFYRQRHNSF
ADFLQAHLHATDLERHAIFTEITTFSRLLTSHDCEILELEVTGRAPKPTLLWLQQFDTEY
SFLKEVRNCLTNTAKCKILIIQTDFEDGIHSAQLIASAKYSAINEINKIQENEDRIFVYF
ITKLSRMGRGTAYVGFHGGLWQSVHIDDLRRSTLMVSDVTRLQHVTISQLFAPGDLPELG
LEHRAEDGHEEAMETEASTSGEVAEVAEEAMETESSEKVGKETSELGGSDVSILDTTRLL
RSCVQSAVGMLRDENESCTRNMRRVVLLLGLLNEDDTCHASFLRVSKMRLNVLLKKQEES
QVHPLEWVAREACNQDALQEAGTFRHKGEMAYIMVQNYMNLSENASNNVPFSWRIKDYLE
ELWVQAQYITDAEGLPKKFVDIFQQTPLGRFLAQLHGETQQELLQCYSKDFILLTMRVST
EEELKFLQMALWSCTRELKAASAAPEEEVSLPWVHLAYQRFRSRLQNFSRILTIYPQVLH
SLMEARRNHELAGCEMTLDAFAAMACTEMLTRDTLKPSPQAWLQLVKNLSMPLELICSDG
HTQGSGSLAQAVIREVRAQWSRIFSTALFVEHVLLGTESQVPELHRLVTEHVFLLDKCLR
ENSDVKTHRPFEAVMSTLCECKERASKTLSRFGVQPCPICLGDAEDPVCLPCDHVHCLRC
LRAWFAPGQMMCPYCLTALPDEFSPAVSQAHREAIEKHARFRQMCNSFFVDLVSTMCFKD
NAPPEKKVIESLLSLLFVQKELLRDAPQRHREHTKSLSPFNDVVDKTPVIRSVILKLLLK
YSFNDVKDYIQEYLTLLKKKAFIIEDKTELYMLFINCLEDSIHEKTSACSRNDELNHLRE
ERRFLKMYSQGRRGREPANEASVEYLQEVARIRLCLDRAADFLSEPEEGPEMAEEKQCYL
RQVKHFCIWVENDWHRVYLVRKLSSQRGMEFVQGLSKPGHPHQWVFPKDVVKQQGLQQDH
PGQMDRYLVYGDEYKALRDAVAKAVLECKPLGIETALKACKTPQNRQSACFLLTLFREVA
VLYRSHSASLHPTPEQREAVSKFIGECKILSPPDISHFATSLVDNSLPLLRAGPSDSNLD
GTVTEMAIHAAAVLLCGQNKLLEPLKNLAFSPANMAHAFLPTMPEDLLAQARRWKGLEGV
HWYTCPNGHPCSVGECGKPMEQSTCIDCHAPIGGINHKPRDGFRLVNDRADRTQTGHVLG
DPQQRDVVTCDRGLPPVVFILIRLLTHLALLLGASQSSQALINIIKPLARDPKGFLQQHI
LKDLEQLAKMLGHSADETITVVHLVLRRLLQGQHQLSSKRLLNFDTRLSTKEMRNNWEKE
IAAVISPELEHLDKTLPTMNNLISQDKRISSNPVAKIIYGDPVTFLPHLPQKSVVHCSKI
WSCRKRITVEYLQHIVEQKNGKERVPILWRFLQKEAELRLVKFLPEILALQRGLVKQFQN
VPQVEYNSIRGFLSKHSSGGLRRLLQNRITVFLSTWNKLRRSLEMNGEINLPKAYCSTDL
DLDADFEILLPRRRGLGLCATALVSYLIRLHNEIVYAVEKLPEGNNSYSVDATEVTDLHV
ISYEVERDLTPLILSNCQYQVEQGRETLQEFDLEKIQQQIVSRFIQGKPRLSLKGIPTLV
YRHDRNYEHLFMDIKNKMAQDSLPSSVISAISGQLQSYSDACEALSVVEVTLGFLSTAGG
DPNMHLNVYTQDILQMGDQTTHVLKALNRCQLKHTIALWQFLSAHKSEQLLRLQKEPFGE
ISSRYKVDLSSENAKLLSTFLNQIGLDAFLLELHEMIILKLKNPQTEGSFNHEWSLRDTL
ISYMETKESEILPEMESQFPEEILLANCVSVWKTAAVLKRNRQIR
Download sequence
Identical sequences H2NUZ3
ENSPPYP00000009784 ENSPPYP00000009784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]