SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2NVE4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2NVE4
Domain Number 1 Region: 76-193
Classification Level Classification E-value
Superfamily Lysozyme-like 4.44e-39
Family C-type lysozyme 0.0000397
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2NVE4
Sequence length 194
Comment (tr|H2NVE4|H2NVE4_PONAB) Sperm acrosome associated 3 {ECO:0000313|Ensembl:ENSPPYP00000009945} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=SPACA3 OC=Catarrhini; Hominidae; Pongo.
Sequence
VHSSPVSSPSVSGSRRPVSCLSSQSSALSQSGGGSTSAAGIEARSRALRRRWCPAGIILL
ALISLLSCLLPASEAKVYGRCELARVLHDFGLDGYRGYSLADWVCLAYFTSGFNTAAVDH
EADGSTNNGIFQINSRRWCRNLTPNVPNVCQMYCSDTVICAMKITQEPQGLGWEAWRHHC
QGKDLTEWVDGCDF
Download sequence
Identical sequences H2NVE4
9600.ENSPPYP00000009945 ENSPPYP00000009945 ENSPPYP00000009945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]