SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2NX01 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2NX01
Domain Number 1 Region: 56-139
Classification Level Classification E-value
Superfamily HMG-box 9.03e-25
Family HMG-box 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2NX01
Sequence length 252
Comment (tr|H2NX01|H2NX01_PONAB) Uncharacterized protein {ECO:0000313|Ensembl:ENSPPYP00000010519} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=HMG20B OC=Catarrhini; Hominidae; Pongo.
Sequence
MSHGPKQPGAAAAPAGGKAPGQHGGFVVTVKQERGEGPRAGEKGSHEEEPVKKRGWPKGK
KRKKILPNGPKAPVTGYVRFLNERREQIRTRHPDLPFPEITKMLGAEWSKLQPTEKQRYL
DEAEREKQQYMKELRAYQQSEAYKMCTEKIQEKKVKKEDSSSGLMNTLLNGHKGGDCDGF
STFDVPIFTEEFLDQNKAREAELRRTGETPTLGTLDFYMARLHGAIERDPAQHEKLIVRI
KEILAQVARDHL
Download sequence
Identical sequences H2NX01
9600.ENSPPYP00000010519 ENSPPYP00000010519 ENSPPYP00000010519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]