SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2NY96 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2NY96
Domain Number 1 Region: 292-349
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.05e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 460-517
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.13e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 348-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.63e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 4 Region: 404-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.67e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 5 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.32e-23
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 6 Region: 236-293
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.05e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 7 Region: 506-558
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.8e-20
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 8 Region: 180-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000216
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 9 Region: 142-192
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000856
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2NY96
Sequence length 568
Comment (tr|H2NY96|H2NY96_PONAB) Zinc finger protein 675 {ECO:0000313|Ensembl:ENSPPYP00000010975} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0050162 OC=Catarrhini; Hominidae; Pongo.
Sequence
MGLLTFRDVAIEFSLEEWQCLDTAQRNLYKNVILENYRNLVFLGIAVSKQDLITCLEQEK
EPLTVKRHEMVDEPPVMCSHFAQEFWPEQNIKDSFEKVTLRRYEKCGNDNFQLKGCKSVD
ECKVHKGGYNGLNQCLPTTQSKMFQCDKYVKVFNKFSHSDRRKIKHVENKPFKCKECGKS
FCMLSHLTRHERNYTKVNFCKCEECEKAFNQSSKLTKHKRIYTCEKLYKCQECDRTFSQF
SNLTEYKKDYTREKPYKCEECGKAFNQSSHLTTHKIIHTGEKPYKCEECGKAFNQFSNLT
THKKIHTGEQPYICEECGKAFTQSSTLTTHKRIHTGEKPYKCEECGKAFNRSSKLTEHKN
IHTGEQPYKCEECGKAFNRSSNLTEHRKIHTEEKPYKCKECGKAFKHSSALTTHKRIHTG
EKPYICEECGKAFNRSSKLTEHKKLHTGKKPYKCEECGKAFIQSSKLTEHKKIHSGEIPY
KCEECGKAFKHSSSLTTHKRIHTGEKPYKCEECGKAFSRSSKLTEHKIIHTGEKPYKCER
CDKAFNQSANLTKHKKIHTGEKLQNWNV
Download sequence
Identical sequences H2NY96
ENSPPYP00000010975 XP_009251367.1.23681 ENSPPYP00000010975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]