SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2NYZ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2NYZ7
Domain Number 1 Region: 737-793
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.89e-23
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 2 Region: 509-566
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.8e-20
Family Classic zinc finger, C2H2 0.0099
Further Details:      
 
Domain Number 3 Region: 778-830
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.52e-19
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 4 Region: 551-603
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000184
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 5 Region: 471-523
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000413
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 6 Region: 594-647
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000172
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 7 Region: 324-379
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000152
Family Classic zinc finger, C2H2 0.058
Further Details:      
 
Domain Number 8 Region: 369-419
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000101
Family Classic zinc finger, C2H2 0.039
Further Details:      
 
Domain Number 9 Region: 132-154,215-242
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000889
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number 10 Region: 21-44,77-104
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000117
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Weak hits

Sequence:  H2NYZ7
Domain Number - Region: 654-681
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00303
Family Classic zinc finger, C2H2 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2NYZ7
Sequence length 886
Comment (tr|H2NYZ7|H2NYZ7_PONAB) Zinc finger protein 574 {ECO:0000313|Ensembl:ENSPPYP00000011231} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=ZNF574 OC=Catarrhini; Hominidae; Pongo.
Sequence
QGLAAAMTEESEETVLYIEHRYVCSECNQLYGSLEEVLMHQNSHVPQQHFELVGVADPGV
TVATDTASGTGLYQTLVQESQYQCLECGQLLMSPSQLLEHHELHLKMMAPQEAVPAEPPP
KAPPLSSSTIHYECVDCKALFASQELWLNHRQTHLRATPTKAPAPVVLGSPVVLGPPVGQ
ARVAVEHSYRKAEEGGEGATVPSAAATTTEVVTEVELLLYKCSECSQLFQLPADFLEHQA
THFPAPVPESQEPALQQEVQASSPAEVPVSQPDPLPASDHSYELRNGEAIGRDRRGRRAR
RNNSGEAGGAATQELFCSACDQLFLSPHQLQQHLRSHREGVFKCPLCSRVFPSPSSLDQH
LGDHSSESHFLCVDCGLAFGTEALLLAHRRAHTPNPLHSCPCGKTFVNLTKFLYHRRTHG
VGGVPLPTTPVPPEEPVIGFPEPAPAETGEPEAPEPPVSEETSAGPAAPGTYRCLLCSRE
FGKALQLTRHQRFVHRLERRHKCSICGKMFKKKSHVRNHLRTHTGERPFPCPDCSKPFNS
PANLARHRLTHTGERPYRCGDCGKAFTQSSTLRQHRLVHAQHFPYRCQECGVRFHRPYRL
LMHRYHHTGEYPYKCRECPRSFLLRRLLEVHQLVVHAGRQPLREHRCAAAAAQAPRRFEC
GTCGKKVGSAARLQAHEAAHAAAGPGEVLAKEPPAPRAPRATRAPVASPAALGGTATASP
APARRRGLECSECKKLFSTETSLQVHRRIHTGERPYPCPDCGKAFRQSTHLKDHRRLHTG
ERPFACEVCGKAFAISMRLAEHRRIHTGERPYSCPDCGKSYRSFSNLWKHRKTHQQQHQA
AVRQQLAEAEAAVGLAVMETAVEALPLVEAIEIYPLAEAEGVQISG
Download sequence
Identical sequences H2NYZ7
ENSPPYP00000011231 9600.ENSPPYP00000011231 ENSPPYP00000011231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]