SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2NZE2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2NZE2
Domain Number 1 Region: 142-190
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000114
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 1164-1213
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000114
Family Myb/SANT domain 0.0039
Further Details:      
 
Domain Number 3 Region: 176-221
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000111
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Weak hits

Sequence:  H2NZE2
Domain Number - Region: 838-867
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00163
Family Classic zinc finger, C2H2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2NZE2
Sequence length 1350
Comment (tr|H2NZE2|H2NZE2_PONAB) Zinc finger protein 541 {ECO:0000313|Ensembl:ENSPPYP00000011382} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=ZNF541 OC=Catarrhini; Hominidae; Pongo.
Sequence
MDQYSLGDEGALPSEMHLPSFSESQGLNCSDTLNRDLGPNTRDFLYADLSGLDPDRSLPT
PDMSSEVLEDNLDTLSLYSGKDSDSVKLLEEYADSESQASLQDLGLGVLKAKEADEGGRA
TSGSARKGKRQHSSPQNPLLDCSLCGKVFSSASSLSKHYLTHSQERKHVCKICSKAFKRQ
DHLTGHMLTHQKTKPFVCIEQGCSKSYCDYRSLRRHYEVQHGLCILKEAPTEEEACGDSP
HAHESAGQLPPSSLRSLVPPEARSPGSLLPHRDLLRRIVSSIVHQKTPSPGPTLAGASDT
EGRNTACPCPASSGSSSCTPAGPPATPAALDTELPEEPRLPQKEPATDVFTAPNSRVAGN
GAPDPPEPEPEPDTALLQARSTAESWPEGGSVPACLPLFRGQMVPASSQPSSHSFQWLRN
LPGCPKSKGNNVFVVHKPSAVPSREGSECGLGLSSASPSEESPPGPGGGLEDALPFPPAL
LRAPGEALSDPRSASGEDDPCAPKKVKLDCDSFLCQNPGEPGLQEAQKPGGLPADALPLF
RQLFLKSQEPLVSHEQMQVFQMITKSQRIFSHAQVAAASSQLPAPEGKPAALRPLQGPWP
QQPPPLAPGVDSLHAGPGNTEAEGSPARRRKTAPGVPREASPGSTRRDAKGGLKVAAFPT
PLAAPSLESSRNPDISSLAKQLRSSKGTLDLGDIFPSTGQRQTQLGGEEPPGASLPRKQA
PAENGAASRTTKGGKGPACSRGGGYRLLGNPRAPRFSGFRKEKAKMDMCCAASPSQVAMA
SFSSAGPPADPSKSKLTIFSRIQGGNIYRLPHPVKEENVAGGGNQQNGSPTDWTEPRSTF
VCKNCSQMFYTEKGLSSHMCFHSDQWPSPRGKQEPQVFGTEFCEPLRQVLRPEGDRHSPP
GAKKPLDPTAAAPLVVPQSIPVVPVTRHIGSMAMEQEKDGEERDSKESSQQRKRKKRPPP
STAGEPGPAGCHQSRLRSPMFLVDRLLKGLFQCSPYTPPPMLSPIREGSGVYFNTLCSTS
TQASPDQLISSMLDQVDGSFGICVVKDDTKISIEPHINIGSRFQAEIPELQERSLAGIDE
HVASLVWKPWGDMMINPETQDRVTELCNLACSSVMPGGGTNLELALHCLHEAQGNVQVAL
ETLLLRGPQKPWTHLLADYRYTGSDVWTPIEKRLFKKAFYAHKKDFYLIHKTIQTKTVAQ
CVEYYYIWKKMIKFDCGRAPGLEKRVKREPEEVERTEEKVPCSPRERPSHHPPPELKIKT
KSYRRESILSSSPNAVPKRTPELSGSAESQGIFPCRECERVFDKIKSRNAHMKRHRLQDH
VEPIIRVKWPVKPFQLKEKELGADIGPLQW
Download sequence
Identical sequences H2NZE2
9600.ENSPPYP00000011382 ENSPPYP00000011382 ENSPPYP00000011382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]