SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2P0D6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2P0D6
Domain Number 1 Region: 212-268
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.82e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 8-67
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-23
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 3 Region: 267-324
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.35e-21
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 331-383
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.88e-19
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2P0D6
Sequence length 388
Comment (tr|H2P0D6|H2P0D6_PONAB) Zinc finger protein 550 {ECO:0000313|Ensembl:ENSPPYP00000011736} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=ZNF550 OC=Catarrhini; Hominidae; Pongo.
Sequence
MAETKDAPQMLVTFKDVAVTFTREEWRQLDLAQRTLYREVMLETCGLLVSLGHRVPKPEL
VHLLEHGQELWTVKRGLSHPTCAGDRAQVHTREPTTYLPVLSERAFLRGSLTLESLTSSD
SRLGRARDEEGLLEMQKGKVTPETDLHKETHRGKVSLEGEGLGTDDGLHSRALQEWLSAD
VLHECDSQQPGKDALIHAGTNPYKCKQCGKGFNRKWYLVRHQRVHTGMKPYECNACGKAF
SQSSTLIRHYLIHTGEKPYKCLECGKAFKRRSYLMQHHPIHTGEKPYECSQCRKAFTHRS
TFIRHNRTHTGEKPFECKKCEKAFXXXXRIHTGEKPYECTQCGKAFHRSTYLIQHSVIHT
GEMPYKCIECGKAFKRRSHLLQHQRVHT
Download sequence
Identical sequences H2P0D6
9600.ENSPPYP00000011736 ENSPPYP00000011736 ENSPPYP00000011736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]