SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2P267 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2P267
Domain Number 1 Region: 232-289
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.89e-22
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 93-149
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.75e-22
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 176-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.64e-21
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 4 Region: 343-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.26e-19
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 5 Region: 390-441
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.94e-18
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 6 Region: 288-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.24e-17
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 7 Region: 36-93
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.18e-16
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 8 Region: 1-50
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000628
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 9 Region: 139-171
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000086
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2P267
Sequence length 443
Comment (tr|H2P267|H2P267_PONAB) Uncharacterized protein {ECO:0000313|Ensembl:ENSPPYP00000012397} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN= OC=Catarrhini; Hominidae; Pongo.
Sequence
ECNQCGETFNRPSKVIQHQSMHSGLKPYKCDVCQKAFRFLSSLSIHQRFHVGKKPFSCDF
CGKTFHRFSEKTQHLLIHTRKKYYTCNYCKKEFNPYSKFILHQRTHTGEKPHKCDVCEKS
FKSISNLNKHQKTHTGEKPFSCNECKKTFAQRTDLARHQQIHTGKKYFICSSCKKTFVRL
SDLTQHQRTHTGERPYQCTTCEKAFKYRSNFTKHQKTHSIGRPFACNECGKTYRLNWELN
QHKKIHTGEKPYECGECGKRFNNNSNLNKHKKIHTGEKHFVCNQCGKAFSLNSKLSRHQR
IHNKKPFSCNECKKAFALRMDLARHQQIHTGRKPFICSNCKKTFVRLSDLTQHKGTHTGE
RPYQCTTCEKAFKYRSNFTKHQKTHSIGTPFTCNECGKTFRLNWKLNQHKKIHTGEKPYE
CGECGKCFNNNSNLSKHKKIHTG
Download sequence
Identical sequences H2P267
ENSPPYP00000012397 ENSPPYP00000012397 9600.ENSPPYP00000012397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]