SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2P2Z9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2P2Z9
Domain Number 1 Region: 108-183
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000157
Family HLH, helix-loop-helix DNA-binding domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2P2Z9
Sequence length 323
Comment (tr|H2P2Z9|H2P2Z9_PONAB) Oligodendrocyte transcription factor 2 {ECO:0000313|Ensembl:ENSPPYP00000012690} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0027335 OC=Catarrhini; Hominidae; Pongo.
Sequence
MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMG
SAGAHPGDKLGGSGFKSSSSSTSSSTSSAAASSTKKDKKQMTEPELQQLRLKINSRERKR
MHDLNIAMDGLREVMPYAHGPSVRKLSKIATLLLARNYILMLTNSLEEMKRLVSEIYGGH
HAGFHPSACGGLAHSAPLPAATAHPAAAAHAAHHPAVHHPILPPAAAAAAAAAAAAAVSS
ASLPGSGLPSVGSIRPPHGLLKSPSAAAAAPLGGGGGGSGASGGFQHWGGMPCPCSMCQV
PPPHHHVSAMGAGSLPRLTSDAK
Download sequence
Identical sequences A0A2I3RXT7 H2P2Z9 Q13516
NP_005797.1.87134 NP_005797.1.92137 XP_005260965.1.92137 XP_009232162.1.23681 XP_016802659.1.37143 9598.ENSPTRP00000023861 9600.ENSPPYP00000012690 9606.ENSP00000331040 ENSP00000331040 ENSPTRP00000023861 ENSPPYP00000012690 ENSPPYP00000012690 gi|17978475|ref|NP_005797.1| ENSPTRP00000023861 ENSP00000331040 ENSP00000371794 ENSP00000331040 ENSP00000371794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]