SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2P581 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2P581
Domain Number 1 Region: 313-416
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.19e-21
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00058
Further Details:      
 
Domain Number 2 Region: 71-143
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000017
Family HLH, helix-loop-helix DNA-binding domain 0.0032
Further Details:      
 
Domain Number 3 Region: 158-217
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000969
Family Heme-binding PAS domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2P581
Sequence length 889
Comment (tr|H2P581|H2P581_PONAB) Neuronal PAS domain protein 2 {ECO:0000313|Ensembl:ENSPPYP00000013492} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=NPAS2 OC=Catarrhini; Hominidae; Pongo.
Sequence
MYTCGFVGRCAPFPAEEGRTFDLSKELGRSVTREGTGTTGLNSEPVPLLCLPLLNCSRKN
CIENLMDEDEKDRAKRASRNKSEKKRRDQFNVLIKELSSMLPGNTRKMDKTTVLEKVIGF
LQKHNEVSAQTEICDIQQDWKPSFLSNEEFTQLMLEALDGFIIAVTTDGSIIYVSDSITP
LLGHLPSDVMDQNLLNFLPEQEHSEVYKILSSHMLVTDSPSPEYLKSDSDLEFYCHLLRG
SLNPKEFPTYEYIKFVGNFRSYNNVPSPSCNGFDNTLSRPCRVPLGKEVCFIATVRLATP
QFLKEMCIVDEPLEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHIDDLEL
LARCHQHLMQFGKGKSCCYRFLTKGQQWIWLQTHYYITYHQWNSKPEFIVCTHSVVSYAD
VRVERRQELALEDPPSEALHSSALKDKGSSLEPRQHFNALDVGASGLNTSHSPSASSRSS
HKSSHTAMSEPTSTPTKLMAEASTPALPRSATLPQELPVPGLSQAATMPAPLPSPSSCDL
TQQLLPQTILQSTPAPMAQFSAQFSMFQTIKDQLEQRTRILQANIRWQQEELHKIQEQLC
LVQDSNVQMFLQQPAVSLSFSSTQRPEAQQQLQQRSAAVTQPQLGAGPQLPGQISSAQVT
SQHLLRESSVISTQGPKPMRSSQLMQSSGRSGSSLVSPFSSATAVLPPSLNLTTPASTSQ
DASQCQPSPDFSHDRQLRLLLSQPIQPMMPGSCDARQPSEVSRTGRQVKYAQSQTVFQNP
DAHPANSSSAPMPVLLMGQAVLHPSFPASQPSPLQPAQARQQPQQHYLQVQAPTSLHSEQ
QDSLLLSTYSQQPGTLGYPQPPPAQPQPLRPPRRVSSLSESSGLQQPPR
Download sequence
Identical sequences H2P581
ENSPPYP00000013492 ENSPPYP00000013492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]