SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2P7S8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2P7S8
Domain Number 1 Region: 310-354
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.05e-16
Family Classic zinc finger, C2H2 0.0021
Further Details:      
 
Domain Number 2 Region: 343-382
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000507
Family Classic zinc finger, C2H2 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2P7S8
Sequence length 398
Comment (tr|H2P7S8|H2P7S8_PONAB) Sp5 transcription factor {ECO:0000313|Ensembl:ENSPPYP00000014424} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0017072 OC=Catarrhini; Hominidae; Pongo.
Sequence
MAAVAVLRNDSLQAFLQDRTPSASPDLGKHSPLALLAATCSRIGQPGATAPPDFLQVPYD
PALGSPSRLFHPWTADMPAHSPGALPPPHPSLGLTPQKTHLQPSFGAAHELPLTPPADPS
YPYEFSPVKMLPSSMAALPASCAPAYVPYAAQAALPPGYSNLLPPPPPPPPPPTCRQLSP
NPAPDDLPWWSIPQAGAGPGASGVPGSGLSGACAGGPHAPRFPASAAAAAAAAAALQRGL
VLGPSDFAQYQSQIAALLQTKAPLAATARRCRRCRCPNCQAAGGAPEAEPGKKKQHVCHV
PGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKSFTRSDELQRHLRTHTGEKRFACPE
CGKRFMRSDHLAKHVKTHQNKKLKVAEAGVKREDARDL
Download sequence
Identical sequences H2P7S8
9600.ENSPPYP00000014424 ENSPPYP00000014424 XP_002812621.1.23681 ENSPPYP00000014424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]