SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2P7Z3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2P7Z3
Domain Number 1 Region: 355-662
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 4.52e-111
Family PDEase 0.0000000886
Further Details:      
 
Domain Number 2 Region: 132-334
Classification Level Classification E-value
Superfamily GAF domain-like 9.81e-43
Family GAF domain 0.00016
Further Details:      
 
Domain Number 3 Region: 53-148
Classification Level Classification E-value
Superfamily GAF domain-like 1.55e-25
Family GAF domain 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2P7Z3
Sequence length 681
Comment (tr|H2P7Z3|H2P7Z3_PONAB) Phosphodiesterase {ECO:0000256|RuleBase:RU363067} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN= OC=Catarrhini; Hominidae; Pongo.
Sequence
MLKQARRPSFQNVLCATQWKKVKNTRLVQISGASLAEKQEKHQDFLIQRQTKTKDRRFND
EIDKLTGYKTKSLLCMPIRSSDGEIIGVAQAINKTPEGAPFTEDDEKVMQMYLPFCGIAI
SNAQLFAASRKEYERSRALLEVVNDLFEEQTDLEKIVKKIMHRAQTLLKCERCSVLLLED
IESPVVKFTKSFELMSPKCSADAENSFKESMEKSSYSDWLINNSIAELVASTGLPVNISD
AYQDPRFDAEADQISGFHIRSVLCVPIWNNNHQIIGVAQVLNRLDGKPFDDADQRLFEAF
VIFCGLGINNTIMYDQVKKSWAKQSVALDVLSYHATCSKAEVDKFKAANIPLVSELAIDD
IHFDDFSLDVDVMITAALRMFMELGMVQKFKIDYETLCRWLLTVRKNYRMVLYHNWRHAF
NVCQLMFAMLTTAGFQEILTEVEILAVIVGCLCHDLDHRGTNNAFQAKSGSALAQLYGTS
ATLEHHHFNHAVMILQSEGHNIFANLSSKEYSDLMQLLKQSILATDLTLYFERRTEFFEL
VSKGEYDWNIKNHRDIFRSMLMTACDLGAVTKPWEISRQVAELVTSEFFGDRERLELKLT
PSAIFDRNRKDELPRLQLEWIDSICMPLYQALVKVNMKLKPMLDSVATNRSKWEELHQKR
LLASTASSSPASVIVAKEDRN
Download sequence
Identical sequences H2P7Z3
ENSPPYP00000014491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]