SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2P8E4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H2P8E4
Domain Number - Region: 5-36
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0298
Family HkH motif-containing C2H2 finger 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2P8E4
Sequence length 1092
Comment (tr|H2P8E4|H2P8E4_PONAB) Uncharacterized protein {ECO:0000313|Ensembl:ENSPPYP00000014650} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN= OC=Catarrhini; Hominidae; Pongo.
Sequence
MQKRQGYCSYCRVQYNNLEQHLFSAQHRSLTRQSRRQICTSSLMERFLQDVLQHHPYHCQ
ESSSTQDETHVNTGSSSEVVHLDDAFSEEEEEEEDEDKVEDEDATEERPSEVSEPIEELH
CRPHKSQEGTQESVRPSVIQKLEKGQQQPLEFVHKIGAGVKKCNLVDIGQATNNGSNLVR
PPVICNAPASCLPESSNDRPVTANTTSLPPAAHLDSVSKCDPNKVEKYVEQPDGASRNPV
PSSHVETSSFSYQKHKESNRKSLRMNSDKLVLWKDVKSQGKTLSAGLKFHERMGTKGSLR
VKSPSKLAVNPNKTDMPSNKGIFEDTIAKNHEEFFSNMDCTQEEKHLVFNKTAFWEQKCS
VSSEMKFDCSSLQSASDQPQETAQDLNLWKEERIDQEDNYESRGSEMSFDCSSSFHSLTD
QSKVSAKEVNLSKEVRTDVQYKNNKSYVSKISSDCDDILHLITNQSQMIVKEISLQNARH
ISLVDQSYESSSSETNFDCDASPQSTSDYPQQSVTEVNLPKEVHIGLVDKNYGSSSSEVS
ADSVFPLQSVVDRPPVAVTETKLRKKAHTGLVDNYGSSCSETSFDCDVSLESVVDHPQLT
VKGRNLKGRQVHLKHKKRKPSSAKAHLDCDVSLGTVADESQRAVEKINLLKEKNADLMDM
NCESHGPEMGFQADAQLADRSQVAEIEPQKVDVDLENKSVRSSRSSLSSDSPASLYHSAH
DEPQEALDEVNLKELNIDMEVKSYDCSSSELTFDSDPPLLSVTEQSHLDAEGKERHIDLE
DESCESDSSEITFDSDIPLYSVIDQPQVAVYEEETVDLESKSNESCVSEITFDSDIPLHS
GNDHPEVAVKEVIQKEEYIHLERKNDEPSGSEISSDSHAPLHSVTNSPEVAVKKLNPQKE
EQVHLENKENEPTDSEVSLDYNIIFHSVTGHSEDPIKEISLHTKEHMYLENKSVFETSLD
SDVPLQAATHKPEVIVKETWLQREKHAEFQDRSTEFSSSKTSLDSGVPHYSVTEPQVAVN
KINRKKQYVLENKNDKCSGSEIILDSNVPPQSMTDQPQLAFLKEKHVNLKDKNSKSGDSK
ITFDSAQLQEAV
Download sequence
Identical sequences H2P8E4
ENSPPYP00000014650 ENSPPYP00000014650 9600.ENSPPYP00000014650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]