SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2P9C3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2P9C3
Domain Number 1 Region: 216-230,356-617
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.23e-63
Family Nuclear receptor ligand-binding domain 0.0000672
Further Details:      
 
Domain Number 2 Region: 147-229
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.66e-32
Family Nuclear receptor 0.0000738
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2P9C3
Sequence length 629
Comment (tr|H2P9C3|H2P9C3_PONAB) Nuclear receptor subfamily 2 group C member 2 {ECO:0000313|Ensembl:ENSPPYP00000014996} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=NR2C2 OC=Catarrhini; Hominidae; Pongo.
Sequence
MATNMEGLVQHRVGTQQVAEVTRTQTSRPESPGMTSPSPRIQIISTDSAVASPQRIQIVT
DQQTGQKIQIVTAVDASGSPKQQFILTSPDGAGTGKVILASPETSSAKQLIFTTSDNLVP
GRIQIVTDSASVERLLGKTDVQRPQVVEYCVVCGDKASGRHYGAVSCEGCKGFFKRSVRK
NLTYSCRSNQDCIINKHHRNRCQFCRLKKCLEMGMKMESVQSERKPFDVQREKPSNCAAS
TEKIYIRKDLRSPLIATPTFVADKDGARQTGLLDPGMLVNIQQPLIREDGTVLLATDSKA
ETSQGALGTLANVVTSLANLSESLNNGDTSEIQPEDQSASEITRAFDTLAKALNTTDSSS
SPSLADGIDTSGGGSIHVISRDQSTPIIEVEGPLLSDTHVTFKLTMPSPMPEYLNVHYIC
ESASRLLFLSMHWARSIPAFQALGQDCNTSLVRACWNELFTLGLAQCAQVMSLSTILAAI
VNHLQNSIQEDKLSGDRIKQVMEHIWKLQEFCNSMAKLDIDGYEYAYLKAIVLFSPDHPG
LTSTSQIEKFQEKAQMELQDYVQKTYSEDTYRLARILVRLPALRLMSSNITEELFFTGLI
GNVSIDSIIPYILKMETAEYNGQITGASL
Download sequence
Identical sequences A0A096NW94 A0A0D9RA21 A0A2K5QYF9 A0A2K6BK06 A0A2K6T536 F7D8H6 H2P9C3
ENSPANP00000017321 XP_003926213.2.74449 XP_005571754.1.63531 XP_007983533.1.81039 XP_008949933.1.60992 XP_009236677.1.23681 XP_009443220.1.37143 XP_011532365.1.92137 XP_011732801.1.29376 XP_011839034.1.47321 XP_011915651.1.92194 XP_014985664.1.72884 XP_017360555.1.71028 XP_017820611.1.60252 ENSPPYP00000014996 ENSPPYP00000014996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]