SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2P9P8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2P9P8
Domain Number 1 Region: 11-77
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000055
Family HLH, helix-loop-helix DNA-binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2P9P8
Sequence length 2239
Comment (tr|H2P9P8|H2P9P8_PONAB) Upstream transcription factor family member 3 {ECO:0000313|Ensembl:ENSPPYP00000015137} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=USF3 OC=Catarrhini; Hominidae; Pongo.
Sequence
MPEMTENETPTKKQHRKKNRETHNAVERHRKKKINAGINRIGELIPCSPALKQSKNMILD
QAFKYITELKRQNDELLLNGGNNEQAEEIKKLRKQLEEIQKENGRYIELLKANDICLYDD
PTIHWKGNLKNSKVSVVIPSDQVQKNIIVYSNGNQPGGNSQGTAVQGITFNVSHNLQKQT
ANVVPVQRTCNLVTPVSISGVYPSENKPWHQTTVPALATNQPVPLCLPAAISAQSILELP
TSESESNVLGATSGSLIAVSIGSEPHQHHSLHTCLNDQNSFENKNGQENPKLLKKMTPCV
TNIPHSSSATATKVHHGNKSCLSIQDFRGDFQNTFVVSVNTTVCSQPPRTADDSSPMIIS
KSADLTSTATVVASSAPGVGKATIPVSTLSGNPLDNGWTLSCSLPSSSVSTSDLKNINSL
TRISSAGNTQTTWTTLQLAGNTIQPLSQTPSSAVTPVLNESGTSPTTSNHSRHVATGINL
NNSFPADGQPVEQVVVTLPSCPSLPMQPLIAQPQVKSQPPKNILPLNSAMQVIQMAQPVG
SAVNAAPANQNVIILQPPSTTPCPTVMRAEVPNQTVGQQIVIIQAANQNPLPLLPAPPPG
SVRLPINGANTVIGSNNSVQNVPTPQTFGGKHLVHILPRPSSLSASSSTQTFSVTMSNQQ
PQTISLNGQLFALQPVMSSSGTTNQTPMQIIQPTTSEDPNTNVALNTFGALASLNQSISQ
MAGQSCVQLSISQPANAQTAANSQTTTANCVSLTTTAAPPVTTDSSATLASTYNLVSTSS
MNTVACLPNMKSKRLNKKPGARKHLAANKSACPLNSVRDVSKLDCPNTEGSAEPSCNDGL
LESFPAVLPSVSMSQANSVSVSASHSLGVLSSESLIPESVSKSKSAEKSSPPSQESVMSE
HFAMATAKSKDSTPNLQQETSQDKPPSSLALSDAAKPCTSANVLIPSPSDPHILVSQVSG
LSSTTSTTSTDCVSEVEIIAEPCRVEQDSSDTMQTTGLLKGQGLTTLLSDLAKKKNPQKS
SLSDQMDHPDFSSENPKIVDSSVNLHPKQELLLMNNDDRDPPQHHSCLPDQEVINGSLIT
GRQADSPMSTSSGSSRSFSVASMLPETTREDVTSNATTNTCDSCTFVEQTDIVALAARAI
FDQENLEKGRVGLQADIREVASKPSEASLLEGHPPFKSQIPKENGTGQAEATSNEFNSQG
SIEATVERTLEKPSCSLGIKTSNASLQDSTSQPPSITSLSVNNLIHQSSISHPLASCAGL
SPTSEQTTVPATVNLTISSSSYGSQPPGPSLMTEYSQEQLNTMTSTIPNSQIQEPLLKPS
HESRKDSAKRAVQDDLLLSSAKRQKHCQPAPLRLESMSLMSRTPDTISDQTQIMVSQIPP
NSSNSVVPVSNPAHGDGLTRLFPPSNNFVAPALRQTEVQCGSQPSVAEQQQTQASQHLQA
LQQHVPAQGVSHLHSNHLYIKQQQQQQQQQQQAGQLRERHHLYQMQHHVPHAESSVHSQP
HNVHQQRTLQQEVQMQKKRNLVQGTQTSQLSLQPKHHGTDQSRSKSGQPHPHHQQMQQQM
QQHFGSSQTEKSCENPSTSRNHHNHPQNHLNQDIMHQQQEVGSRQQGSGVSSEHVSGHNP
MQRLLTSRGLEQQIVSQPSIVTRSSDMTCTPHRPERNRVSSYSAEALIGKTSSNSEQRMG
ISIQGSRVSDQLEMRSYLDVPRNKSLAIHNMQGRVDHTVASDIRLSDCQTFKPSGASQQP
QSNFEVQSSRNNEIGNPVSSLRSMQSQAFRISQNTGPPPIDRQKRLPYPPVQSIPTGNGI
PSRDSENTCHQSFMQSLLAPHLSDQVIGSQRSLSEHQRNTQCGTSSAIEYNCPPTHENVH
IRRESESQNRESCDMSLGAINARNSTLNIPFSSSSSSGDIQGRNTSPNVSVQKSNPMRIT
DSHATKGHMNPPVTTNMHGVARPALPHPSVSHGNGDQGPAVRQANSSVPQRSRHPLQDSS
GSKIRQPERNRSGNQRQSTVFDPSLPHLPLSTGGSMILGRQQPATEKRGSIVRFMPDSPQ
VPNDNSGPDQHTLSQNFGFSFIPEGGMNPPINANASFIPQVTQPSATRTPALIPVDPQNT
LPSFYPPYSPAHPTLSNDISIPYFPNQMFSNPSTEKVNSGSLNNRFGSILSPPRPVGFAQ
PSFPLLPDMPPMHMTNSHLSNFNMTSLFPEIATALPDGSAMSPLLTIANSSASDSSKQSS
NRPAHNISHILGHDCSSAV
Download sequence
Identical sequences H2P9P8
ENSPPYP00000015137 9600.ENSPPYP00000015137 ENSPPYP00000015137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]