SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2PAA2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2PAA2
Domain Number 1 Region: 301-368
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.7e-16
Family HLH, helix-loop-helix DNA-binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2PAA2
Sequence length 520
Comment (tr|H2PAA2|H2PAA2_PONAB) Melanogenesis associated transcription factor {ECO:0000313|Ensembl:ENSPPYP00000015346} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0039651 OC=Catarrhini; Hominidae; Pongo.
Sequence
MQSESGIVPDFEVGEEFHEEPKTYYELKSQPLKSSSSAEHPGASKPPISSSSMTSRILLR
QQLMREQMQEQERREQQQKLQAAQFMQQRVPVSQTPAINVSVPTTLPSATQVPMEVLKVQ
THLENPTKYHIQQAQRQQVKQYLSTTLANKHANQVLSLPCPNQPGDHVMPPVPGSSAPNS
PMAMLTLNSNCEKEGFYKFEEQNRVESECPGMNTHSRASCMQMDDVIDDIISLESSYNEE
ILGLMDPALQMANTLPVSGNLIDLYGNQGLPPPGLTISNSCPANLPNIKRELTESEARAL
AKERQKKDNHNLIERRRRFNINDRIKELGTLIPKSNDPDMRWNKGTILKASVDYIRKLQR
EQQRAKELENRQKKLEHANRHLLLRIQELEMQARAHGLSLIPSTGLCSPDLVNRIIKQEP
VLENCSQDLLQHHADVTCTTTLDLTDGTITFNNNLGTGTEANQAYSVPTKMGSKLEDILM
DDTLSPVGVTDPLLSSVSPGASKTSSRRSSMSMEETEHAC
Download sequence
Identical sequences H2PAA2
ENSPPYP00000015346 ENSPPYP00000015346 XP_002813580.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]