SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2PBI9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2PBI9
Domain Number 1 Region: 3-95
Classification Level Classification E-value
Superfamily HMG-box 3.93e-30
Family HMG-box 0.00000951
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2PBI9
Sequence length 240
Comment (tr|H2PBI9|H2PBI9_PONAB) SRY-box 14 {ECO:0000313|Ensembl:ENSPPYP00000015813} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0032574 OC=Catarrhini; Hominidae; Pongo.
Sequence
MSKPSDHIKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSEAEKRPYIDE
AKRLRAQHMKEHPDYKYRPRRKPKNLLKKDRYVFPLPYLGDTDPLKAAGLPVGASDGLLS
APEKARAFLPPASAPYSLLDPAQFSSSAIQKMGEVPHTLATGALPYASTLGYQNGAFGSL
SCPSQHTHTHPSPTNPGYVVPCNCTTWSASTLQPPVAYILFPGMTKTGIDPYSSAHATAM
Download sequence
Identical sequences H2PBI9
ENSPPYP00000015813 XP_002814130.1.23681 ENSPPYP00000015813 9600.ENSPPYP00000015813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]