SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2PBZ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H2PBZ5
Domain Number - Region: 12-170
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0675
Family Voltage-gated potassium channels 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2PBZ5
Sequence length 207
Comment (tr|H2PBZ5|H2PBZ5_PONAB) Claudin {ECO:0000256|RuleBase:RU060637} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0034710 OC=Catarrhini; Hominidae; Pongo.
Sequence
MVATCLQVVGFVTSFVGWIGVIVTTSTNDWVVTCGYTIPTCRKLDELGSKGLWADCVMAT
GLYHCKPLVDILILPGYVQACRALMIAASVLGLPAILLLLTVLPCIRMGQEPGVAKYRRA
QLAGVLLILLALCAIVATIWFPVCAHRETTIVSFGYSLYAGWIGAVLCLVGGCVILCCAG
DAQAFGENRFYYTAGSSSPTHAKSAHV
Download sequence
Identical sequences A0A2I2ZIY0 H2PBZ5
9600.ENSPPYP00000015975 ENSGGOP00000027164 XP_002814320.1.23681 XP_004038046.1.27298 ENSPPYP00000015975 ENSGGOP00000027164 ENSPPYP00000015975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]