SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2PCQ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2PCQ5
Domain Number 1 Region: 21-102
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000196
Family HLH, helix-loop-helix DNA-binding domain 0.0000611
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2PCQ5
Sequence length 178
Comment (tr|H2PCQ5|H2PCQ5_PONAB) MAX dimerization protein 4 {ECO:0000313|Ensembl:ENSPPYP00000016249} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=MXD4 OC=Catarrhini; Hominidae; Pongo.
Sequence
VLPSTGIRQEKQGGQLVRKAPNNRSSHNELEKHRRAKLRLYLEQLKQLVPLGPDSTRHTT
LSLLKRAKVHIKKLEEQDRRALSIKEQLQQEHRFLKRRLEQLSVQSVERVRTDSTGSAVS
TDDSEQEVDIEGMEFGPGELDSVGSSSDADDHYSLQSGTGGDSGFGPHCRRLGRPALS
Download sequence
Identical sequences H2PCQ5
9600.ENSPPYP00000016249 ENSPPYP00000016249 ENSPPYP00000016249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]