SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2PCW5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2PCW5
Domain Number 1 Region: 5-119
Classification Level Classification E-value
Superfamily POZ domain 2.56e-29
Family BTB/POZ domain 0.00087
Further Details:      
 
Domain Number 2 Region: 433-489
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.11e-20
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 3 Region: 530-582
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.67e-19
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 4 Region: 489-545
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-18
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 5 Region: 394-446
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-17
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Weak hits

Sequence:  H2PCW5
Domain Number - Region: 360-408
Classification Level Classification E-value
Superfamily Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain 0.000419
Family Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2PCW5
Sequence length 766
Comment (tr|H2PCW5|H2PCW5_PONAB) Zinc finger and BTB domain containing 49 {ECO:0000313|Ensembl:ENSPPYP00000016311} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0036153 OC=Catarrhini; Hominidae; Pongo.
Sequence
MDPVATHSCHLLQQLHEQRIQGLLCDCMLVVKGVCFKAHKNVLAAFSQYFRSLFQNSSSQ
KNDVFHLDVKNVSGIGQILDFMYTSHLDLNQDNIQVMLDTAQCLQVQNVLSLCHTFLKSA
TVVQPPGMPCNSTLSLQSTLTPDATCVISENSYPPHFLQECSADAQQDKTLDESHPRASP
SVSRHHSAGEISKQAPDTSDGSCTELPFKQPNYYYKLRNFYSKQYHKHTAGPSQERVIEQ
PFAFSTSTDLTTVESQPCAVSHSECILESPEHLPSNFLAQPVNESAPHPESEATCQQPAK
QMRLKKAIHLKKLNFLKSQKSAEQVSEPKSDDGLTKRMESASENTLEKASSGSAEEKESE
EVVSCENFNCISETERPEDPAALEDQSQTLQSQRQYACELCGKPFKHPSNLELHKRSHTG
EKPFECNICGKHFSQAGNLQTHLRRHSGEKPYICEICGKRFAASGDVQRHIIIHSGEKPH
LCDICGRGFSNFSNLKEHKKTHTADKVFTCDECGKSFNMQRKLVKHRIRHTGERPYSCSA
CGKCFGGSGDLRRHVRTHTGEKPYTCEICNKCFTRSAVLRRHKKMHCKAGDESPDVLEEL
SQAIETSDLEKSQSSDSFSQDTSVTLMPVSVKLPVHPVENSVAEFDSHSGGSYCKLRSMI
QPHGVSDQEKLSLDPGKLAKPQMQQTQPQAYAYSDADTSAGGEPLQADGMAMIRSSLAAL
DNHGGDPLGSRASSTTYRNSEGQFFSSMTLWGLAMKTLQNENELDQ
Download sequence
Identical sequences H2PCW5
9600.ENSPPYP00000016311 ENSPPYP00000016311 ENSPPYP00000016311 XP_002814625.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]