SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2PES2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2PES2
Domain Number 1 Region: 98-160
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.45e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2PES2
Sequence length 217
Comment (tr|H2PES2|H2PES2_PONAB) Heart and neural crest derivatives expressed 2 {ECO:0000313|Ensembl:ENSPPYP00000016990} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=HAND2 OC=Catarrhini; Hominidae; Pongo.
Sequence
MSXVGGFPHHPVVHHEGYPFAAAAAAAAAAAASRCSHEENPYFHGWLIGHPEMSPPDYSM
ALSYSPEYASGAAGLDHSHYGGVPPGAGPPGLGGPRPVKRRGTANRKERRRTQSINSAFA
ELRECIPNVPADTKLSKIKTLRLATSYIAYLMDLLAKDDQNGEAEAFKAEIKKTDVKEEK
RKKELNEILKSTVSSNDKKTKGRTGWPQHVWALELKQ
Download sequence
Identical sequences H2PES2
ENSPPYP00000016990 ENSPPYP00000016990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]