SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2PHH4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2PHH4
Domain Number 1 Region: 44-111
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000138
Family HkH motif-containing C2H2 finger 0.00053
Further Details:      
 
Domain Number 2 Region: 192-238
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000714
Family HkH motif-containing C2H2 finger 0.012
Further Details:      
 
Domain Number 3 Region: 253-281
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000527
Family HkH motif-containing C2H2 finger 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2PHH4
Sequence length 291
Comment (tr|H2PHH4|H2PHH4_PONAB) Uncharacterized protein {ECO:0000313|Ensembl:ENSPPYP00000017998} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN= OC=Catarrhini; Hominidae; Pongo.
Sequence
MEYPAPAAVQAADGGGAGPYNSSELLEGQEPDGVRFDRERARRLWEAVSGAQPVGREEVE
HMIQKNQCLFTNTQCKVCCALLISESQKLAHYQSKKHANKVKRYLAIHGMETLKGETKKL
DSDQPASRLVCDRNAGCPLCPAFTFHFSFTASAHFLDKGKHGRVPHPAVGLTALSKRLTN
PFLVASTLALHQNREMIDPDKFCSLCHATFNDPVMAQHYVGKKHRKQETKLKLMARYGRL
ADPAVTDFPAGKGYPCKTCKIVLNSIEQYQAHVSGFKHKNQSPKTVASSLG
Download sequence
Identical sequences H2PHH4
ENSPPYP00000017998 9600.ENSPPYP00000017998 ENSPPYP00000017998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]