SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2PHU9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2PHU9
Domain Number 1 Region: 97-147
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.86e-16
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 1568-1617
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.01e-16
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 3 Region: 1247-1294
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000656
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 4 Region: 670-719
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000031
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 5 Region: 642-677
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000146
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 6 Region: 754-809
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000117
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 7 Region: 207-253
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000597
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number 8 Region: 39-85
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000144
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Weak hits

Sequence:  H2PHU9
Domain Number - Region: 1445-1475
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000257
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number - Region: 312-340
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000423
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2PHU9
Sequence length 1742
Comment (tr|H2PHU9|H2PHU9_PONAB) Ras responsive element binding protein 1 {ECO:0000313|Ensembl:ENSPPYP00000018124} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0009301 OC=Catarrhini; Hominidae; Pongo.
Sequence
MTSRSPVGLEGSDLSSINTMMSAVMSVGKVTENGGSPQGIKSPSKPPGPNRIGRRNQETK
EEKSSYNCPLCEKICTTQHQLTMHIRQHNTDTGGADHSCSICGKSLSSASSLDRHMLVHS
GERPYKCTVCGQSFTTNGNMHRHMKIHEKDPNSATATAPPSPLKRRRLSSKRKLSHDAES
EREDPAPAKKMVEDGQSGDSEKKADEVFHCPVCFKEFVCKYGLETHMETHSDNPLRCDIC
CVTFRTHRGLLRHNALVHKQLPRDAMGRPFIQNNPSIPAGFHDLGFTDFSCRKFPRISQA
WCETNLRRCISEQHRFVCDTCDKAFPMLCSLALHKQTHVAADQGQEKPQATPPPGDALDQ
KGFLALLGLQHTKDVRPAPAEEPLPDDNQAIQLQTLKCQLPQDPGCTNLLSLSPFEAASL
GGSLTVLPATKDGIKHLSLQPFQKGFIIQPDSSIVVKPISGESAIELADIQQILKMAASA
PPQISLPPFSKAPAAPLQAIFKHMPPLKPKPLVTPRTVVATSTPPPLINAQQASPGCISP
SLPPPPLKLLKGSVEAASNAHLLQSKSGTQPSAATRLSLQQPRAELPGQPEMKTQLEQDS
IIEALLPLSMEAKIKQEITEGELKAFMTAPSGKKTPAMRKVLYPCRFCNQVFAFSGVLRA
HVRSHLGISPYQCNICDYIAADKAALIRHLRTHSGERPYICKICHYPFTVKANCERHLRK
KHLKATRKDIEKNIEYVSSSAAELVDAFCAPDTVCRLCGEDLKHYRALRIHMRTHCGRGL
GGGHKGRKPFECKECSAAFAAKRNCIHHILKQHLHVPEQDIESYVLAADGLGPAEAPAAE
ASGRGEDSGCAALGDCKPLTAFLEPQNGFLHRGPTQPPPPQVSIKLEPSSSFAVDFNEPL
DFSQKGLALVQVKQENISFLSPSSLAPYDCSMEPIDLSIPKNFRKGDKDLATPSEAKKPE
QEAGSSEQPSPCSAPGPSLPVTLGPSGILESPMAPAPAATPEPPAQPLQGPVQLAVPIYS
SALVSSPPLVGSSALLSGTALLRPLRPKPPLLLPKPPVTEELPPLASIAQIISSVSSAPT
LLKTKVADPGPASTGSNTTASDSLGGSVPKAATTAAPAATTSPKESSEPPAPASSPEAAS
PTEQCPAGTSKKRGRKRGVRSRPRANSSGVDLDSSGEFASIEKMLATTDTNKFSPFLQTA
EDNTQDEVAGAPADHHGPSDEEQGSPPEDKLLRAKRNSYTNCLQKITCPHCPRVFPWASS
LQRHMLTHTGQKPFPCQKCDAFFSTKSNCERHQLRKHGVTTCSLRRNGLIPQSKESDVGS
HDSTDSQSDAETAAAAGEVLDLTSRDREQPSEGATELRQVAGDAPVEQAEAETASPVHRE
EHAPGESQEPEEEHGTEESAGDADCAEEDASSNQSLDLDFASKLMDFKLAEGEGEAGAGG
AASQEQKLACDTCGKSFKFLGTLSRHRKAHGRQDPKDEKGDGASTAEEGPQPAPEQEENP
PETPVGVVESAPGAGEASVEKPAEETEGPSDGESAAEKRSSEKSDDDKKPKTDSPKSVAS
KADKRKKVCSVCNKRFWSLQDLTRHMRSHTGERPYKCQTCERTFTLKHSLVRHQRIHQKA
RHAKHHGRDSDKEERGEEDSENESTHSGNNPVSENEAELAPNANNHMAVTRSRKEGLASA
TKDCSHREEKVMAGRPSEPGQGDLNPESPAALGQDLLEPRSKRPAHPTLATADGASQLLG
ME
Download sequence
Identical sequences H2PHU9
ENSPPYP00000018124 9600.ENSPPYP00000018124 ENSPPYP00000018124 ENSPPYP00000024282 XP_002816437.1.23681 XP_009239681.1.23681 XP_009239682.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]