SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2PIW0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2PIW0
Domain Number 1 Region: 21-135
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.21e-21
Family Synaptotagmin-like (S variant) 0.038
Further Details:      
 
Domain Number 2 Region: 256-436
Classification Level Classification E-value
Superfamily vWA-like 6.67e-18
Family Integrin A (or I) domain 0.018
Further Details:      
 
Domain Number 3 Region: 171-226
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000067
Family Synaptotagmin-like (S variant) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2PIW0
Sequence length 523
Comment (tr|H2PIW0|H2PIW0_PONAB) Copine 5 {ECO:0000313|Ensembl:ENSPPYP00000018514} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CPNE5 OC=Catarrhini; Hominidae; Pongo.
Sequence
MEQPEDMASLSEFDSLAGSIPATKVEITVSCRNLLDKDMFSKSDPLCVMYTQGMENKQWR
EFGRTEVIDNTLNPDFVRKFIVDYFFEEKQNLRFDLYDVDSKSPDLSKHDFLGQAFCTLG
EIVGSPGSRLEKPLTIGAFSLNSRTGKPMPAVSNGGVPGKKCGTIILSAEELSNCRTIKV
EVYDWDRDGSHDFIGEFTTSYRELARGQSQFNIYEVVNPKKKMKKKKYVNSGTVTLLSFA
VESECTFLDYIKGGTQINFTVAIDFTASNGNPSQSTSLHYMSPYQLNAYALALTAVGEII
QHYDSDKMFPALGFGAKLPPDGRVSHEFPLNGNQENPSCCGIDGILEAYHRSLRTVQLYG
PTNFAPVVTHVARNAAAVQDGSQYSVLLIITDGVISDMAQTKEAIVNAAKLPMSIIIVGV
GQAEFDAMVELDGDDVRISSRGKLAERDIVQFVPFRDYVDRTGNHVLSMARLARDVLAEI
PDQLVSYMKAQGIRPRPPPAAPTHSPSQSPARTPPASPLHTHI
Download sequence
Identical sequences H2PIW0
ENSPPYP00000018514 ENSPPYP00000018514 9600.ENSPPYP00000018514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]