SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2PK07 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2PK07
Domain Number 1 Region: 336-560
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.38e-35
Family Calponin-homology domain, CH-domain 0.00035
Further Details:      
 
Domain Number 2 Region: 85-236,327-410
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.7e-22
Family FAD/NAD-linked reductases, N-terminal and central domains 0.061
Further Details:      
 
Domain Number 3 Region: 671-702
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000903
Family LIM domain 0.00066
Further Details:      
 
Domain Number 4 Region: 638-670
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000158
Family LIM domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2PK07
Sequence length 1015
Comment (tr|H2PK07|H2PK07_PONAB) Microtubule associated monooxygenase, calponin and LIM domain containing 1 {ECO:0000313|Ensembl:ENSPPYP00000018929} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=MICAL1 OC=Catarrhini; Hominidae; Pongo.
Sequence
MASPTSTNPAHAHFESFLQAQLCQDVLSSFQELCGALGLEPGGGLPQYHKIKNQLNYWSA
KSLWTKLDKRAGQPVYQQGRACTSTKCLVVGAGPCGLRVAVELALLGARVVLVEKRTKFS
RHNVLHLWPFTIHDLRALGAKKFYGRFCTGTLDHISIRQLQLLLLKVALLLGVEIHWGVT
FTGLQPPSRKGSGWRAQLQPNPPAQLANYEFDVLISAAGGKFVPEGIDLENIVYYKDDTH
YFVMTAKKQCLLRLGVLRQDWPDTDRLLGSANVVPEALQRFAREAADFATHGKLGKLEFA
QDAHGQPDVSAFDFTSMMRAESSVRVQERHGARLLLGLVGDCLVEPFWPLGTGVARGFLA
AFDAAWMVKRWAEGAESLEVLAERESLYQLLSQTSPENMHRNVAQYGLDPATRYPNLNLR
AVTPNQVRDLYDVLAKEPVQRNGDKTDTGMPVTGSAGTQEELLRWCQEQTAGYPGVHVSD
LSSSWADGLALCALVHRLQPDLLEPSELQGLGALEATAWALKVAEHELGITPVVSAQAMV
AGSDPLGLIAYLSHFHSAFKSAAHSPGPVSQASPGTSSAVLFLGKLQRTLQRSRAKENAE
DAGGKKLRLEMEAETPSTEVPPDPEPGVPLTPPSQHQEASAGDLCALCGEHLYVLERLCV
DGHFFHRSCFRCHTCEATLWPGGYERHPGDGHFYCLQHLPQPDHKEEGSDGGPESPELPT
PSENSMPPGLSTPTASQEGAGPVPDPSQPTRRRIRLSSPERQRLSSLNLTPDPEMEPPPK
PPRSCSALARHALESSFVGWGLPVQSPQALVAMEKEEEESPFSSEEEEEDVPLDSDVEQA
LQTFAKTSGTMNNYPTWRRTLLRRAKEEEMKRFCKAQTIQRRLNEIEAALRELEAEGVKL
ELALRRQSSSPEQQKKLWVGQLLQLVDKKNSLVAEEAELMITVQELNLEEKQWQLDQELR
GYMNQEETLKTAADRQAEDQVLRKLVDLVNQRDALIRFQEERRLSELALGTGAQG
Download sequence
Identical sequences H2PK07
ENSPPYP00000018929 ENSPPYP00000018929 9600.ENSPPYP00000018929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]