SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2PKS6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2PKS6
Domain Number 1 Region: 1-134,246-385
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.63e-54
Family CAF1-like ribonuclease 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2PKS6
Sequence length 530
Comment (tr|H2PKS6|H2PKS6_PONAB) Poly(A)-specific ribonuclease PNLDC1 {ECO:0000313|Ensembl:ENSPPYP00000019204} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=PNLDC1 OC=Catarrhini; Hominidae; Pongo.
Sequence
MDVGADEFEESLPLLQELVQEADFVGLDIEFTGLRSNLSGPQQISLFDLPSEWYLKTRQS
VQQFTICQIGDSIVSPWEPEFFKWYTAHSCNFYLFPTTFGILDSEFSFQASSVQFLNQYG
FNYNKFLKNGIPYMNEEQEKKIRHDILTGNWRVRSSPDKDQIKVVIDEVTRWLDLAKEGD
WMTLPGITGFQAFEVQLVLRQALPNIWTVLKDEGVVVKKVSKQHRWYLQNTSCDRESCWK
ENILLSARGFSAFFQMLVKAQKPLVGHNMMMDLLHLHEKFFRPLPESYDQFKQNIHSLFP
VLIDTKSVTKDIWKVMNRIALAGVQWRDLGSLQPPTPLMGRVSNDCSILSPPVETKCPHE
AAYDAFLCGSVLLKVAHLLLQKVHRIDPVPESSFPQYLDVLAPYVNQVNLIRAGVPKINF
SGPDYPGIRPPILILSVKRWPGVSEQQVYHKFQNLCKFDVRRLTRSQFLLLTNKFKDARN
ILKEYRGHPTLCISLYRYWRHSPNVNCLLQVCGIVTAWALLAFTLGRSGP
Download sequence
Identical sequences H2PKS6
ENSPPYP00000019204 ENSPPYP00000019204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]