SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2PL60 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2PL60
Domain Number 1 Region: 82-199
Classification Level Classification E-value
Superfamily POZ domain 4.45e-27
Family BTB/POZ domain 0.001
Further Details:      
 
Domain Number 2 Region: 556-608
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000109
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Weak hits

Sequence:  H2PL60
Domain Number - Region: 531-565
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000206
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2PL60
Sequence length 683
Comment (tr|H2PL60|H2PL60_PONAB) Zinc finger and BTB domain containing 22 {ECO:0000313|Ensembl:ENSPPYP00000019338} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=ZBTB22 OC=Catarrhini; Hominidae; Pongo.
Sequence
QDGGGRGPGCCCGRRVRGGGGPGARGPRPPRPPSSFLCSCGWGGIPSLHNMEPSPLSPSG
AALPLPLSLAPPPLPLPAAAVVHVSFPEVTSALLESLNQQRLQGQLCDVSIRVQGREFRA
HRAVLAASSPYFHDQVLLKGMTSISLPSVMDPGAFETVLASAYTGRLSMAAADIVNFLTV
GSVLQMWHIVDKCTELLREGRASATTTITTAAATSVTVPGAGVPSGSGGSVAPATMGSAR
SHASSRASENQSPSSSNYFSPRESTDFSSSSQEAFAASAVGSGERRGGGPVFPAPVVGSG
GATSGKLLLEADELCDDGGDGRGAVVPGAGLRKPTYTPPSIMPQKHWVYVKRGGNCPAPA
PLVPQDPDLEEEEEEEDLVLTCEDDEDEELGGSSRVPVGGGPEATLSISDVRTLSEPPDK
GEEQVNFCESSNDFGPYEGGGPVAGLDDSGGPTPSSYAPSHPPRPLLPLDMQGNQILVFP
SSSSSSSQAPGQPPGNQAEHGAVTVGGTSVGSLGVPGSVGGVPGGTGSGDGNKIFLCHCG
KAFSHKSMRDRHVNMHLNLRPFDCPVCNKKFKMKHHLTEHMKTHTGLKPYECGVCAKKFM
WRDSFMRHRGHCERRHRLGGVGAGPGPGTPTGPSLPSKRESPGAGGGSGDEASAATPPSS
RRVWSPPSVHKVEMGFGGGGGAN
Download sequence
Identical sequences H2PL60
ENSPPYP00000019338 ENSPPYP00000019338 9600.ENSPPYP00000019338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]