SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2PLH0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2PLH0
Domain Number 1 Region: 75-135
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 5.1e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2PLH0
Sequence length 190
Comment (tr|H2PLH0|H2PLH0_PONAB) Basic helix-loop-helix family member a15 {ECO:0000313|Ensembl:ENSPPYP00000019452} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0048462 OC=Catarrhini; Hominidae; Pongo.
Sequence
MKTKNRPPRRRAPVQDTEATPGEGTPDGSLPNPGPEPAKGLRSRPARAAAGAPGEGRRRR
PGPSGPAGRRDSSIQRRLESNERERQRMHKLNNAFQALREVIPHVRADKKLSKIETLTLA
KNYIKSLTATILTMSSSRLPGLEGPGPKLYQHYQQQQQQVAGGALGATEAQPQGHLQRYS
TQIHSFREGT
Download sequence
Identical sequences H2PLH0
XP_009240821.1.23681 ENSPPYP00000019452 ENSPPYP00000019452 9600.ENSPPYP00000019452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]