SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2PLL3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2PLL3
Domain Number 1 Region: 208-265
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.46e-27
Family Classic zinc finger, C2H2 0.0025
Further Details:      
 
Domain Number 2 Region: 264-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.96e-26
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 320-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.65e-25
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 4 Region: 46-104
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.41e-21
Family KRAB domain (Kruppel-associated box) 0.0021
Further Details:      
 
Domain Number 5 Region: 377-424
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.64e-20
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 6 Region: 173-222
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000846
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2PLL3
Sequence length 446
Comment (tr|H2PLL3|H2PLL3_PONAB) Zinc finger protein 3 {ECO:0000313|Ensembl:ENSPPYP00000019495} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=ZNF3 OC=Catarrhini; Hominidae; Pongo.
Sequence
METQADLVSQEPQALLDSALPSKVPAFSDKDSLGDEMLAAALLKAKSQELVTFEDVAVYF
IRKEWKRLEHAQRDLYRDVMLENYGNVFSLDHETRTENDQEICEDTRSHGVLLGRFQKDI
SQGLKFKEAYEREVSLKRPLGNSPGERLNRKMPDCGQVTVEEKLTPRGERSEKYNDFGNS
FTVNSNLISHQRHSVGDRPHKCDECSKSFNRTSDLIQHQRIHTGEKPYECNECGKAFSQS
SHLIQHQRIHTGEKPYECSDCGKTFSCSSALILHRRIHTGEKPYECNECGKTFSWSSTLT
HHQRIHTGEKPYACNECGKAFSRSSTLIHHQRIHTGEKPYECNECGKAFSQSSHLYQHQR
IHTGEKPYECMECGGKFTYSSGLIQHQRIHTGENPYECSECGKAFRYSSALVRHQRIHTG
EKPLNGMGMSKSSLRVTTELNIREST
Download sequence
Identical sequences H2PLL3
XP_009240879.1.23681 XP_009240880.1.23681 XP_009240881.1.23681 XP_009240882.1.23681 ENSPPYP00000019495 ENSPPYP00000019495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]