SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2PMI5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2PMI5
Domain Number 1 Region: 274-468
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.28e-58
Family BCR-homology GTPase activation domain (BH-domain) 0.00000000418
Further Details:      
 
Domain Number 2 Region: 24-159
Classification Level Classification E-value
Superfamily SH2 domain 6.06e-27
Family SH2 domain 0.0000000867
Further Details:      
 
Domain Number 3 Region: 204-268
Classification Level Classification E-value
Superfamily Cysteine-rich domain 5.53e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000369
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2PMI5
Sequence length 468
Comment (tr|H2PMI5|H2PMI5_PONAB) Chimerin 2 {ECO:0000313|Ensembl:ENSPPYP00000019823} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0019428 OC=Catarrhini; Hominidae; Pongo.
Sequence
MAASSNSSLSGSSVSSDAEEYQPPIWKSYLYQLQQEAPRPKRIICPREVENRPKYYGREF
HGIISREQADELLGGVEGAYILRESQRQPGCYTLALRFGNQTLNYRLFHDGKHFVGEKRF
ESIHDLVTDGLITLYIETKAAEYISKMTTNPIYEHIGYATLLREKVSRRLSRSKNEPRKT
NVTHEEHTAVEKISSLVRRAALTHNDNHFNYEKTHNFKVHTFRGPHWCEYCANFMWGLIA
QGVRCSDCGLNVHKQCSKHVPNDCQPDLKRIKKVYCCDLTTLVKAHNTQRPMVVDICIRE
IEARGLKSEGLYRVSGFTEHIEDVKMAFDRDGEKADISANVYPDINIITGALKLYFRDLP
IPVITYDTYSKFIDAAKISNADERLEAVHEVLMLLPPAHYETLRYLMIHLKKVTMNEKDN
FMNAENLGIVFGPTLMRPPEDSTLTTLHDMRYQKLIVQILIENEDVLF
Download sequence
Identical sequences A0A2K5DCU7 A0A2K5RFP7 A0A2K6T0W1 F7E8S7 G3RAD4 H2PMI5 H2R2E9 P52757
ENSCJAP00000015559 ENSP00000222792 ENSPPYP00000019823 ENSGGOP00000012403 ENSP00000222792 NP_004058.1.87134 NP_004058.1.92137 XP_002751486.1.60252 XP_002818142.1.23681 XP_003318423.1.37143 XP_003807933.1.60992 XP_003935216.1.74449 XP_012303192.1.9421 XP_017382558.1.71028 XP_018886686.1.27298 gi|4757980|ref|NP_004058.1| 9598.ENSPTRP00000043836 9600.ENSPPYP00000019823 9606.ENSP00000222792 ENSPTRP00000043836 ENSGGOP00000012403 ENSPPYP00000019823 ENSPTRP00000043836 ENSCJAP00000015478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]