SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2PMQ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2PMQ8
Domain Number 1 Region: 102-161
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.84e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2PMQ8
Sequence length 166
Comment (tr|H2PMQ8|H2PMQ8_PONAB) Fer3 like bHLH transcription factor {ECO:0000313|Ensembl:ENSPPYP00000019899} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0019613 OC=Catarrhini; Hominidae; Pongo.
Sequence
MAAYPESCVDATVLDFVADLSLASPRRPLLCDFAPGVSLGDPALALREGRPRRMARFEEG
DPEEEECEVDKGDGEEEEEEERGRGVSLLGRPKRKRVITYAQRQAANIRERKRMFNLNEA
FDQLRRKVPTFAYEKRLSRIETLRLAIVYISFMTELLESCEKKESG
Download sequence
Identical sequences H2PMQ8
9600.ENSPPYP00000019899 ENSPPYP00000019899 ENSPPYP00000019899 XP_002818223.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]