SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2PNL3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2PNL3
Domain Number 1 Region: 52-112
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000576
Family HLH, helix-loop-helix DNA-binding domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2PNL3
Sequence length 330
Comment (tr|H2PNL3|H2PNL3_PONAB) Stimulated by retinoic acid 8 {ECO:0000313|Ensembl:ENSPPYP00000020227} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0022953 OC=Catarrhini; Hominidae; Pongo.
Sequence
MGKIDMDKILIFNQEIRLWQLIMATPEENSNPHDRTTPQLPAQLQELEHRVARRRLSQAR
HRATLAALFNNLRKTVYSQSDLTASKWQVLNKAKSHIPELEQTLDNLLKLKASFNLEDGH
ASSLEEVKKEYASMYSGNDSFPQNGSSPWYLNFYKQTMDLLTGSGIITPQEAALPIVSAA
ISHLWQNLSEERKASLRQAWAQKHRGPATLAEACREPACAEGSVKDSGVDSQGASCSLVS
TPEEILFEDAFDVASFLDKSEVPSTSSSSSVLASCNPENPEEKFQLYMQIIDFFKGLSCA
NTQVKQEASFPVDEEMIMLQCTETFDDEDL
Download sequence
Identical sequences H2PNL3
ENSPPYP00000020227 XP_002818518.1.23681 ENSPPYP00000020227 9600.ENSPPYP00000020227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]