SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2PPE1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2PPE1
Domain Number 1 Region: 69-128
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.18e-20
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 2 Region: 5-65
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000162
Family Complement control module/SCR domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2PPE1
Sequence length 134
Comment (tr|H2PPE1|H2PPE1_PONAB) Uncharacterized protein {ECO:0000313|Ensembl:ENSPPYP00000020510} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN= OC=Catarrhini; Hominidae; Pongo.
Sequence
LPSHTCGNPGEILKGVLHGTRFNIGDKIRYSCLSGYILEGHAILTCIVSPGNGASWDFPA
PFCRAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILAEPGDTIALVFTDFQLEEGY
DFLEISGTEAPSIW
Download sequence
Identical sequences G7N0E9 G7PCC2 H2PPE1
ENSPPYP00000020510 ENSGGOP00000012180 ENSGGOP00000012180 ENSPPYP00000020510 9600.ENSPPYP00000020510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]