SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2PPQ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2PPQ6
Domain Number 1 Region: 16-92
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 1.09e-21
Family Nucleoplasmin-like core domain 0.00028
Further Details:      
 
Weak hits

Sequence:  H2PPQ6
Domain Number - Region: 98-126
Classification Level Classification E-value
Superfamily ARM repeat 0.00345
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2PPQ6
Sequence length 187
Comment (tr|H2PPQ6|H2PPQ6_PONAB) Nucleophosmin/nucleoplasmin 2 {ECO:0000313|Ensembl:ENSPPYP00000020627} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=NPM2 OC=Catarrhini; Hominidae; Pongo.
Sequence
MNLSSASSTEEKAVTTVLWGCELSQERRTWTFRPQLEGKQSCRLLLNTVTIASLQASVLP
MVSTVGVQLSPPVTFQLRAGSGPVFLSGQERYEASDLTWEEEEEEEGEEEEEEEEEEDDE
DEDADVSLEEESPVKQVKRLVPQKQASMAKKKKLEKEQEEIRASVRDKSPAKKAKATARA
KKPGFKK
Download sequence
Identical sequences H2PPQ6
ENSPPYP00000020627 9600.ENSPPYP00000020627 ENSPPYP00000020627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]